Dine Droop
Dine DroopDining Insightsrestaurants near me
ConnecticutNew JerseyNew York

Dine Drooprestaurants near meNew YorkKings CountyPark Sloperestaurants in Flatbush AvenueBKLYN CREPE
BKLYN CREPE ico

BKLYN CREPE
- 214 Flatbush Ave, Brooklyn, NY 11217

Juice shop, Cafe ★4.0 (28)·$10–20

214 Flatbush Ave, Brooklyn, NY 11217, USA

4.0
Visited twice with my friend and we loved this place. On both occasions we were served fresh, hot crepes with delicious filling and fresh juices. Really delicious food! Highly recommended if you’re craving crepes. Service was great too. - Malia Alderson
BKLYN CREPE Overview Intro Food & drink Detail Photos Location Reviews
$10–20 per person Reported by 28 people$1–10$10–20$20–30$30–50

BKLYN CREPE Introduce

Introduction / Overview: Your Essential Brooklyn Stop for Freshness and Flavor

BKLYN CREPE, nestled right on Flatbush Avenue in the heart of Brooklyn, is far more than just a typical juice shop. It is a vibrant, multifaceted cafe and creperie that has skillfully blended the world of fresh, high-quality juices and smoothies with a diverse, satisfying menu of savory and sweet crepes, healthy salads, and grain bowls. For New Yorkers prioritizing fast service, fresh ingredients, and genuine customization, BKLYN CREPE is an indispensable local treasure.

This establishment has built a reputation on two main pillars: health and versatility. While the commitment to freshly pressed juices and superfood-packed smoothies is a major draw, with standout options like the custom-strength Super Green Juice, the menu quickly expands to offer a complete meal solution for any time of the day. The crepes, prepared hot and fresh, are a signature item, with both traditional and innovative fillings named after classic Brooklyn neighborhoods—from the Prospect Heights savory chicken crepe to the sweet, nutty Dumbo.

The atmosphere is consistently described as casual and trendy, fostering a welcoming environment that is good for kids, friendly to the LGBTQ+ community, and highly popular for solo dining. In a city where time and quality are precious, BKLYN CREPE stands out as the ultimate spot for a fast, delicious, and genuinely healthy boost, whether you’re grabbing a fresh juice on the go or settling in for a satisfying meal.

Location and Accessibility

BKLYN CREPE is perfectly situated at 214 Flatbush Ave, Brooklyn, NY 11217, USA, a prime location in the Prospect Heights neighborhood near the bustling border of several key areas, including Park Slope and Downtown Brooklyn. Its position on Flatbush Avenue makes it a highly convenient stop for local residents and commuters alike.

The venue is dedicated to accessibility, featuring a wheelchair accessible entrance and a wheelchair accessible restroom, ensuring comfort for all patrons. For those visiting with their four-legged friends, dogs are permitted outside, allowing for a quick and friendly grab-and-go experience. While street parking is available, it is metered (paid street parking), which is typical for this busy area of Brooklyn. However, its proximity to major subway hubs provides easy access via public transit, making it an effortlessly reachable destination for anyone in the greater New York region.

Services Offered

BKLYN CREPE offers an extensive range of food and beverage services designed to meet the fast-paced and health-conscious demands of the New York consumer.

  • Fresh Juice Bar: Serving a variety of specialized Fresh Juices (like Super Green Juice and Gingerade Juice) and custom options, with an emphasis on fresh, high-quality ingredients and customizable ginger strength.
  • Smoothie and Protein Shake Menu: A wide selection of nutrient-dense Fruit Smoothies (such as Gold Coast and Berry Buzz) and specialized Protein Shakes (Purple Punch and Protein Power).
  • Creperie Services: Providing a comprehensive menu of Savory Crepes (e.g., Bay Ridge with smoked salmon) and Sweet Crepes (e.g., Dumbo with Nutella, banana, and almonds), all made fresh to order.
  • Healthy Meal Prep: Offering pre-designed and customizable Salads and Grain Bowls (like the Bed Stuy Vegan grain bowl and Windsor Terrace salad) suitable for lunch or dinner.
  • Dietary Accommodation: Extensive options available, including numerous labeled Vegan and Gluten-Free crepes, bowls, and beverages.
  • Snacks and Health Shots: A small selection of supplementary items like Health Shots (Tumeric, Ginger, Wheatgrass), Beet Chips, and fresh-cut fruit (Orange Slices, Apple Slices).
  • Ice Cream and Dessert: A dedicated dessert menu featuring Ice Cream, Milkshakes, and Root Beer Floats alongside sweet crepes.
  • Convenient Service Options: Delivery, Takeout, Onsite services, and Dine-in available, often with fast turnaround times.
  • Bulk Ordering: Offers Bulk Juices & Smoothies in gallon-sized (4 Quarts) containers, ideal for parties, catering, or weekly health routines.

Features / Highlights

What sets BKLYN CREPE apart for a New York audience are its unique features that blend healthy eating with convenience and neighborhood charm.

  • Unmatched Customization and Freshness: Customers have the ability to create their own custom savory and sweet crepes, salads, grain bowls, and juices. This bespoke service, coupled with a demonstrated commitment to freshness (noted by the "hot and fresh crepes" and fresh juice preparation), is a significant highlight.
  • Robust Vegan and Gluten-Free Offerings: The inclusion of several specific, neighborhood-named vegan and gluten-free crepes (Williamsburg, Bushwick, Flatbush), along with vegan options in the bowl and salad categories, makes it a reliable destination for various dietary needs.
  • Fast and Efficient Service: Highlighted by customer reviews, the "Fast service" ensures that busy New Yorkers can quickly grab a healthy, substantial meal or drink without significant delay.
  • Creative, Localized Menu Naming: Naming menu items after Brooklyn neighborhoods (Bay Ridge, Park Slope, Dumbo, Flatbush) adds a charming, local touch that resonates deeply with New York residents.
  • Health-Focused Specialty Drinks: The menu goes beyond basic juice to include functional drinks like the Cold Buster Juice (Turmeric, Carrot, Orange, Ginger) and specialized Protein Shakes, catering directly to health and fitness goals.
  • All-Day Appeal: By offering everything from a quick morning Wheatgrass Shot to a full Savory Crepe lunch and an Ice Cream dessert option, the cafe serves the community from breakfast through dinner.

Contact Information

To place a pickup order, inquire about catering, or for general questions, please use the contact details below. For the fastest service, online ordering is also highly recommended.

  • Address: 214 Flatbush Ave, Brooklyn, NY 11217, USA
  • Phone Number: (718) 638-1023

What is Worth Choosing: Custom Health & Culinary Versatility

Choosing BKLYN CREPE is choosing unparalleled versatility without sacrificing quality. For a New York patron, what makes this establishment truly worth choosing is its dual mastery of fresh health drinks and satisfying, high-quality cafe fare. Many places do juice well, and many places do crepes well, but few execute both with the level of quality and customization offered here.

The ability to meticulously craft your own meal—from selecting the ingredients for a Custom Juice (and even specifying your ginger strength, as one review notes) to building a Custom Savory Crepe—puts the power of healthy eating directly into the customer's hands. This is an incredible value in a city that often demands quick, pre-packaged solutions.

Furthermore, BKLYN CREPE proves that convenience and fresh food can coexist. The consistent positive feedback regarding the hot, delicious food and the vibrant freshness of the juices confirms that the business maintains high standards across its diverse menu. Whether you are a dedicated vegan seeking the Flatbush (Vegan + GF) crepe, a health enthusiast craving a Super Green Juice, or a family looking for a quick, kid-friendly treat, this Flatbush Avenue spot expertly delivers a high-quality, personalized, and efficient dining experience. It is the essential Brooklyn stop for health, flavor, and convenience.

BKLYN CREPE Food & drink

  • SAVORY CREPES

  • Bushwick (Vegan + GF) $16.00

    Vegan Mozzarella / roasted peppers / spinach / truffle oil on a Gluten free + vegan crepe

  • Bensonhurst $15.00

    prosciutto / fresh mozzarella / roasted pepper / pesto (contains cheese and pine nuts)

  • Bay Ridge $17.00

    smoked salmon/ goat cheese / spinach / caramelized onion / lemon oil drizzle

  • Park Slope (New Recipe) $14.00

    goat cheese / butternut squash / spinach / tomato / extra virgin olive oil

  • Flatbush (Vegan + GF) $15.00

    butternut squash / mushroom / avocado / carrot /garic tarragon drizzle on a Vegan/GF crepe

  • Prospect Heights $16.00

    roast chicken / swiss cheese / caramelized onions / pesto (contains cheese and pine nuts)

  • Boerum Hill *New* $13.00

    2 eggs / Vermont aged cheddar / roasted mushroom

  • Williamsburg (Vegan + GF) *New* $14.00

    Kale / Beet / Spiced Chickpeas / cherry tomato / Tahini caper drizzle on a Vegan/GF Crepe

  • Custom Savory Crepe $6.00

    made your own crepe

  • FRUIT SMOOTHIES

  • Custom Smoothie $10.50

    Make your own smoothie

  • Blue Ginger Smoothie $11.50

    Blueberry, ginger, coconut, carrot, pineapple juice

  • Pink Drink Smoothie $11.50

    strawberry, pineapple, cranberry, agave, oat milk

  • Berry Buzz Smoothie $11.50

    Strawberry, banana, blueberry, honey, oatmilk.

  • Green Mango Smoothie $11.50

    Mango, Mint, Spinach, honey, pineapple juice

  • Protein Power Shake $11.50

    Peanut butter, banana, Ghirardelli chocolate, almond milk, Whey isolate protein.

  • Gold Coast Smoothie $11.50

    Coconut, mango, lime, pineapple juice, vitamin c.

  • SALADS

  • Crown Heights Salad $16.50

    butternut squash / baked mushroom / roasted pepper / spiced chickpea / red cabbage / avocado

  • Custom Salad $7.50

    create your own salad

  • Canarsie $18.50

    smoked salmon / feta / cucumber / pickled onion / beet / avocado

  • Windsor Terrace $17.50

    roast chicken / fresh mozzarella / carrot / cherry tomato / dill cucumber / avocado

  • GRAIN BOWLS

  • Fort Greene $17.50

    roast chicken / Vermont Cheddar / roasted pepper / beet / carrot

  • Bed Stuy (Vegan) $16.50

    butternut squash / baked mushrooms / caramelized onion / red cabbage / spiced chickpeas

  • Custom Grain Bowl $7.50

    create your own bowl

  • Gowanus $18.50

    smoked salmon / goat cheese / cucumber / pickled onion / tomato

  • Bulk Juices & Smoothies

  • 4 Quarts Smoothie (1 Gallon) $60.00

    Write in the notes which Smoothies you would like

  • 4 Quarts Juice (1 Gallon) $60.00

    Write in the notes which Juices you would like

  • SWEET CREPES

  • Sunset Park (Vegan) $15.00

    Cookie Butter / dark chocolate / toasted coconut on a GF/Vegan crepe

  • Vegan + Gluten Free Dumbo $16.00

    Vegan nutella / strawberry / banana / toasted almonds with Vegan/GF batter

  • Dumbo $15.00

    Strawberry / banana / nutella / toasted almonds

  • Coney Island $11.00

    Nutella / banana

  • Custom Sweet Crepe $6.50

    Make your own sweet crepe

  • Dyker Heights $13.00

    marshmellow fluff / dark chocolate / graham cracker crumble

  • Sheepshead Bay $14.00

    cinnamon apple / dulce de leche / salted butter

  • Brighton Beach (Vegan + GF) $14.00

    Lemon / Strawberry / organic maple syrup on a vegan/GF crepe

  • Red Hook $12.00

    Dark chocolate / strawberry

  • Snacks

  • Orange Slices $3.00
  • Beet Chips $6.00

    100 grams beet chips

  • Dried Mango $6.00

    200 grams dried mango

  • Roasted Almonds (Unsalted) $6.00
  • Apple Slices $3.00

    apple type varies by season

  • HEALTH SHOTS

  • Tumeric + Ginger Shot 2 Oz $6.00

    turmeric + ginger

  • Ginger Shot 2 Oz $5.00

    pure fresh ginger

  • Wheatgrass Shot 2 Oz $6.50

    Chock full of vitamins and nutrients

  • Wheatgrass And Ginger 2 Oz $6.50

    wheatgrass with a touch of ginger

  • PROTEIN SHAKES

  • Purple Punch $12.50

    Strawberry, Blueberry, Cranberry, Acai, Oatmilk, Whey Isolate protein

  • Protein Power $10.50

    Peanut Butter / Banana / Ghirardelli Chocolate / Almond milk / Whey protein isolate

  • Banana Bread $12.50

    Banana / Walnuts / Cinnamon / Honey / Whole milk / Whey Isolate protein

  • FRESH JUICES

  • Cold Buster Juice $11.50

    Turmeric, carrot, orange, ginger.

  • Super Green Juice $11.50

    kale, cucumber, apple, celery.

  • Empowermint Juice $11.50

    Mint, lemon, apple, cucumber

  • Custom Juice $11.50

    Make your own juice

  • Mr. Clean Juice $11.50

    Apple, carrot, ginger, beet.

  • Unbeetable Juice $11.50

    Beet / orange / carrot / lime

  • Gingerade Juice $11.50

    ginger / kale / apple / lime

  • ICE CREAM

  • 1 Scoop $7.00

    1 scoop

  • Root Beer Float (W/Vanilla Ice Cream) $9.00

    16 ounces. choose your milk and any flavor. toppings optional (will come on the side)

  • Pint $12.00
  • Milkshake $11.00

    16 ounces with your choice of up to 2 flavors and milk.

BKLYN CREPE Details

  • Service options

  • Delivery
  • Onsite services
  • Takeout
  • Dine-in
  • Highlights

  • Fast service
  • Popular for

  • Solo dining
  • Accessibility

  • Wheelchair accessible entrance
  • Wheelchair accessible restroom
  • Wheelchair accessible parking lot
  • Dining options

  • Dessert
  • Table service
  • Amenities

  • Gender-neutral restroom
  • Restroom
  • Wi-Fi
  • Atmosphere

  • Casual
  • Trendy
  • Crowd

  • LGBTQ+ friendly
  • Payments

  • Credit cards
  • Debit cards
  • NFC mobile payments
  • Credit cards
  • Children

  • Good for kids
  • Parking

  • Paid street parking
  • Pets

  • Dogs allowed outside

BKLYN CREPE Photos

BKLYN CREPE Picture 1BKLYN CREPE Picture 2BKLYN CREPE Picture 3BKLYN CREPE Picture 4BKLYN CREPE Picture 5BKLYN CREPE Picture 6BKLYN CREPE Picture 7BKLYN CREPE Picture 8BKLYN CREPE Picture 9BKLYN CREPE Picture 10

BKLYN CREPE Location

BKLYN CREPE

214 Flatbush Ave, Brooklyn, NY 11217, USA

BKLYN CREPE Reviews

An average rating of ★4.4 from 391 user reviews.

smoothiessaladpricegluten freehealthysweetveganshakesspinachginger

★ 5★ 4★ 3★ 2★ 1

More restaurants near me

  • DSK BrooklynDSK Brooklyn4.0 (786 reviews)

    710 Fulton St, Brooklyn, NY 11217, USA

  • Yang No 1 AsianYang No 1 Asian3.0 (114 reviews)

    109 S Portland Ave, Brooklyn, NY 11217, USA

  • Hua LongHua Long3.0 (80 reviews)

    706 Fulton St, Brooklyn, NY 11217, USA

  • Roll & X Deli & GrillRoll & X Deli & Grill3.0 (38 reviews)

    698 Fulton St, Brooklyn, NY 11217, USA

  • Not Ray's PizzaNot Ray's Pizza4.0 (675 reviews)

    694 Fulton St, Brooklyn, NY 11217, USA

  • SluttyVegan BrooklynSluttyVegan Brooklyn4.0 (457 reviews)

    690 Fulton St, Brooklyn, NY 11217, USA

  • Hungry GhostHungry Ghost4.0 (465 reviews)

    781 Fulton St, Brooklyn, NY 11217, USA

  • Teou2019s Gelato StandTeou2019s Gelato Stand4.0 (10 reviews)

    781 Fulton St, Brooklyn, NY 11217, USA

  • Forma Pasta FactoryForma Pasta Factory4.0 (963 reviews)

    5 Greene Ave, Brooklyn, NY 11238, USA

  • Yori BoxYori Box5.0 (114 reviews)

    1 Greene Ave, Brooklyn, NY 11238, USA

  • EndswellEndswell4.0 (407 reviews)

    773 Fulton St, Brooklyn, NY 11217, USA

  • TheodoraTheodora4.0 (486 reviews)

    7 Greene Ave, Brooklyn, NY 11238, USA

  • Categories

    Top Visited Sites

    Top restaurants Searches

    Trending Dining Insights Posts