BKLYN CREPE Introduce
Introduction / Overview: Your Essential Brooklyn Stop for Freshness and Flavor
BKLYN CREPE, nestled right on Flatbush Avenue in the heart of Brooklyn, is far more than just a typical juice shop. It is a vibrant, multifaceted cafe and creperie that has skillfully blended the world of fresh, high-quality juices and smoothies with a diverse, satisfying menu of savory and sweet crepes, healthy salads, and grain bowls. For New Yorkers prioritizing fast service, fresh ingredients, and genuine customization, BKLYN CREPE is an indispensable local treasure.
This establishment has built a reputation on two main pillars: health and versatility. While the commitment to freshly pressed juices and superfood-packed smoothies is a major draw, with standout options like the custom-strength Super Green Juice, the menu quickly expands to offer a complete meal solution for any time of the day. The crepes, prepared hot and fresh, are a signature item, with both traditional and innovative fillings named after classic Brooklyn neighborhoods—from the Prospect Heights savory chicken crepe to the sweet, nutty Dumbo.
The atmosphere is consistently described as casual and trendy, fostering a welcoming environment that is good for kids, friendly to the LGBTQ+ community, and highly popular for solo dining. In a city where time and quality are precious, BKLYN CREPE stands out as the ultimate spot for a fast, delicious, and genuinely healthy boost, whether you’re grabbing a fresh juice on the go or settling in for a satisfying meal.
Location and Accessibility
BKLYN CREPE is perfectly situated at 214 Flatbush Ave, Brooklyn, NY 11217, USA, a prime location in the Prospect Heights neighborhood near the bustling border of several key areas, including Park Slope and Downtown Brooklyn. Its position on Flatbush Avenue makes it a highly convenient stop for local residents and commuters alike.
The venue is dedicated to accessibility, featuring a wheelchair accessible entrance and a wheelchair accessible restroom, ensuring comfort for all patrons. For those visiting with their four-legged friends, dogs are permitted outside, allowing for a quick and friendly grab-and-go experience. While street parking is available, it is metered (paid street parking), which is typical for this busy area of Brooklyn. However, its proximity to major subway hubs provides easy access via public transit, making it an effortlessly reachable destination for anyone in the greater New York region.
Services Offered
BKLYN CREPE offers an extensive range of food and beverage services designed to meet the fast-paced and health-conscious demands of the New York consumer.
- Fresh Juice Bar: Serving a variety of specialized Fresh Juices (like Super Green Juice and Gingerade Juice) and custom options, with an emphasis on fresh, high-quality ingredients and customizable ginger strength.
- Smoothie and Protein Shake Menu: A wide selection of nutrient-dense Fruit Smoothies (such as Gold Coast and Berry Buzz) and specialized Protein Shakes (Purple Punch and Protein Power).
- Creperie Services: Providing a comprehensive menu of Savory Crepes (e.g., Bay Ridge with smoked salmon) and Sweet Crepes (e.g., Dumbo with Nutella, banana, and almonds), all made fresh to order.
- Healthy Meal Prep: Offering pre-designed and customizable Salads and Grain Bowls (like the Bed Stuy Vegan grain bowl and Windsor Terrace salad) suitable for lunch or dinner.
- Dietary Accommodation: Extensive options available, including numerous labeled Vegan and Gluten-Free crepes, bowls, and beverages.
- Snacks and Health Shots: A small selection of supplementary items like Health Shots (Tumeric, Ginger, Wheatgrass), Beet Chips, and fresh-cut fruit (Orange Slices, Apple Slices).
- Ice Cream and Dessert: A dedicated dessert menu featuring Ice Cream, Milkshakes, and Root Beer Floats alongside sweet crepes.
- Convenient Service Options: Delivery, Takeout, Onsite services, and Dine-in available, often with fast turnaround times.
- Bulk Ordering: Offers Bulk Juices & Smoothies in gallon-sized (4 Quarts) containers, ideal for parties, catering, or weekly health routines.
Features / Highlights
What sets BKLYN CREPE apart for a New York audience are its unique features that blend healthy eating with convenience and neighborhood charm.
- Unmatched Customization and Freshness: Customers have the ability to create their own custom savory and sweet crepes, salads, grain bowls, and juices. This bespoke service, coupled with a demonstrated commitment to freshness (noted by the "hot and fresh crepes" and fresh juice preparation), is a significant highlight.
- Robust Vegan and Gluten-Free Offerings: The inclusion of several specific, neighborhood-named vegan and gluten-free crepes (Williamsburg, Bushwick, Flatbush), along with vegan options in the bowl and salad categories, makes it a reliable destination for various dietary needs.
- Fast and Efficient Service: Highlighted by customer reviews, the "Fast service" ensures that busy New Yorkers can quickly grab a healthy, substantial meal or drink without significant delay.
- Creative, Localized Menu Naming: Naming menu items after Brooklyn neighborhoods (Bay Ridge, Park Slope, Dumbo, Flatbush) adds a charming, local touch that resonates deeply with New York residents.
- Health-Focused Specialty Drinks: The menu goes beyond basic juice to include functional drinks like the Cold Buster Juice (Turmeric, Carrot, Orange, Ginger) and specialized Protein Shakes, catering directly to health and fitness goals.
- All-Day Appeal: By offering everything from a quick morning Wheatgrass Shot to a full Savory Crepe lunch and an Ice Cream dessert option, the cafe serves the community from breakfast through dinner.
Contact Information
To place a pickup order, inquire about catering, or for general questions, please use the contact details below. For the fastest service, online ordering is also highly recommended.
- Address: 214 Flatbush Ave, Brooklyn, NY 11217, USA
- Phone Number: (718) 638-1023
What is Worth Choosing: Custom Health & Culinary Versatility
Choosing BKLYN CREPE is choosing unparalleled versatility without sacrificing quality. For a New York patron, what makes this establishment truly worth choosing is its dual mastery of fresh health drinks and satisfying, high-quality cafe fare. Many places do juice well, and many places do crepes well, but few execute both with the level of quality and customization offered here.
The ability to meticulously craft your own meal—from selecting the ingredients for a Custom Juice (and even specifying your ginger strength, as one review notes) to building a Custom Savory Crepe—puts the power of healthy eating directly into the customer's hands. This is an incredible value in a city that often demands quick, pre-packaged solutions.
Furthermore, BKLYN CREPE proves that convenience and fresh food can coexist. The consistent positive feedback regarding the hot, delicious food and the vibrant freshness of the juices confirms that the business maintains high standards across its diverse menu. Whether you are a dedicated vegan seeking the Flatbush (Vegan + GF) crepe, a health enthusiast craving a Super Green Juice, or a family looking for a quick, kid-friendly treat, this Flatbush Avenue spot expertly delivers a high-quality, personalized, and efficient dining experience. It is the essential Brooklyn stop for health, flavor, and convenience.
BKLYN CREPE Food & drink
SAVORY CREPES
- Bushwick (Vegan + GF) $16.00
Vegan Mozzarella / roasted peppers / spinach / truffle oil on a Gluten free + vegan crepe
- Bensonhurst $15.00
prosciutto / fresh mozzarella / roasted pepper / pesto (contains cheese and pine nuts)
- Bay Ridge $17.00
smoked salmon/ goat cheese / spinach / caramelized onion / lemon oil drizzle
- Park Slope (New Recipe) $14.00
goat cheese / butternut squash / spinach / tomato / extra virgin olive oil
- Flatbush (Vegan + GF) $15.00
butternut squash / mushroom / avocado / carrot /garic tarragon drizzle on a Vegan/GF crepe
- Prospect Heights $16.00
roast chicken / swiss cheese / caramelized onions / pesto (contains cheese and pine nuts)
- Boerum Hill *New* $13.00
2 eggs / Vermont aged cheddar / roasted mushroom
- Williamsburg (Vegan + GF) *New* $14.00
Kale / Beet / Spiced Chickpeas / cherry tomato / Tahini caper drizzle on a Vegan/GF Crepe
- Custom Savory Crepe $6.00
made your own crepe
FRUIT SMOOTHIES
- Custom Smoothie $10.50
Make your own smoothie
- Blue Ginger Smoothie $11.50
Blueberry, ginger, coconut, carrot, pineapple juice
- Pink Drink Smoothie $11.50
strawberry, pineapple, cranberry, agave, oat milk
- Berry Buzz Smoothie $11.50
Strawberry, banana, blueberry, honey, oatmilk.
- Green Mango Smoothie $11.50
Mango, Mint, Spinach, honey, pineapple juice
- Protein Power Shake $11.50
Peanut butter, banana, Ghirardelli chocolate, almond milk, Whey isolate protein.
- Gold Coast Smoothie $11.50
Coconut, mango, lime, pineapple juice, vitamin c.
SALADS
- Crown Heights Salad $16.50
butternut squash / baked mushroom / roasted pepper / spiced chickpea / red cabbage / avocado
- Custom Salad $7.50
create your own salad
- Canarsie $18.50
smoked salmon / feta / cucumber / pickled onion / beet / avocado
- Windsor Terrace $17.50
roast chicken / fresh mozzarella / carrot / cherry tomato / dill cucumber / avocado
GRAIN BOWLS
- Fort Greene $17.50
roast chicken / Vermont Cheddar / roasted pepper / beet / carrot
- Bed Stuy (Vegan) $16.50
butternut squash / baked mushrooms / caramelized onion / red cabbage / spiced chickpeas
- Custom Grain Bowl $7.50
create your own bowl
- Gowanus $18.50
smoked salmon / goat cheese / cucumber / pickled onion / tomato
Bulk Juices & Smoothies
- 4 Quarts Smoothie (1 Gallon) $60.00
Write in the notes which Smoothies you would like
- 4 Quarts Juice (1 Gallon) $60.00
Write in the notes which Juices you would like
SWEET CREPES
- Sunset Park (Vegan) $15.00
Cookie Butter / dark chocolate / toasted coconut on a GF/Vegan crepe
- Vegan + Gluten Free Dumbo $16.00
Vegan nutella / strawberry / banana / toasted almonds with Vegan/GF batter
- Dumbo $15.00
Strawberry / banana / nutella / toasted almonds
- Coney Island $11.00
Nutella / banana
- Custom Sweet Crepe $6.50
Make your own sweet crepe
- Dyker Heights $13.00
marshmellow fluff / dark chocolate / graham cracker crumble
- Sheepshead Bay $14.00
cinnamon apple / dulce de leche / salted butter
- Brighton Beach (Vegan + GF) $14.00
Lemon / Strawberry / organic maple syrup on a vegan/GF crepe
- Red Hook $12.00
Dark chocolate / strawberry
Snacks
- Orange Slices $3.00
- Beet Chips $6.00
100 grams beet chips
- Dried Mango $6.00
200 grams dried mango
- Roasted Almonds (Unsalted) $6.00
- Apple Slices $3.00
apple type varies by season
HEALTH SHOTS
- Tumeric + Ginger Shot 2 Oz $6.00
turmeric + ginger
- Ginger Shot 2 Oz $5.00
pure fresh ginger
- Wheatgrass Shot 2 Oz $6.50
Chock full of vitamins and nutrients
- Wheatgrass And Ginger 2 Oz $6.50
wheatgrass with a touch of ginger
PROTEIN SHAKES
- Purple Punch $12.50
Strawberry, Blueberry, Cranberry, Acai, Oatmilk, Whey Isolate protein
- Protein Power $10.50
Peanut Butter / Banana / Ghirardelli Chocolate / Almond milk / Whey protein isolate
- Banana Bread $12.50
Banana / Walnuts / Cinnamon / Honey / Whole milk / Whey Isolate protein
FRESH JUICES
- Cold Buster Juice $11.50
Turmeric, carrot, orange, ginger.
- Super Green Juice $11.50
kale, cucumber, apple, celery.
- Empowermint Juice $11.50
Mint, lemon, apple, cucumber
- Custom Juice $11.50
Make your own juice
- Mr. Clean Juice $11.50
Apple, carrot, ginger, beet.
- Unbeetable Juice $11.50
Beet / orange / carrot / lime
- Gingerade Juice $11.50
ginger / kale / apple / lime
ICE CREAM
- 1 Scoop $7.00
1 scoop
- Root Beer Float (W/Vanilla Ice Cream) $9.00
16 ounces. choose your milk and any flavor. toppings optional (will come on the side)
- Pint $12.00
- Milkshake $11.00
16 ounces with your choice of up to 2 flavors and milk.
BKLYN CREPE Details
Service options
- Delivery
- Onsite services
- Takeout
- Dine-in
Highlights
- Fast service
Popular for
- Solo dining
Accessibility
- Wheelchair accessible entrance
- Wheelchair accessible restroom
- Wheelchair accessible parking lot
Dining options
- Dessert
- Table service
Amenities
- Gender-neutral restroom
- Restroom
- Wi-Fi
Atmosphere
- Casual
- Trendy
Crowd
- LGBTQ+ friendly
Payments
- Credit cards
- Debit cards
- NFC mobile payments
- Credit cards
Children
- Good for kids
Parking
- Paid street parking
Pets
- Dogs allowed outside
BKLYN CREPE Photos










BKLYN CREPE Location
BKLYN CREPE Reviews
smoothiessaladpricegluten freehealthysweetveganshakesspinachginger
★ 5★ 4★ 3★ 2★ 1Visited twice with my friend and we loved this place. On both occasions we were served fresh, hot crepes with delicious filling and fresh juices. Really delicious food! Highly recommended if you’re craving crepes. Service was great too.
May 05 · Malia AldersonHighly recommend the Super Green juice!! Incredibly fresh and I appreciated that they asked how strong I like my ginger. They don’t skimp on the quantity. Really made my morning start off great!
April 08 · MichelleDelicious! Grateful for the gluten free option of batter - costs $1.50 extra but still grateful. I ordered the bay ridge and it was huge and delicious - very filling!The staff was super kind and the space was bigger than expected from outside. I heard a couple people come in and ask for coffee, and they happily advised the customer to go to a location nearby (they don’t have coffee)The crepes are high quality and delicious. Lots of variety. It would be fun to go back and try all different kinds. They have a good balance of savory and sweet ones. Also an extensive juice and smoothie list.
April 20 · Lo WoodCute place for a quick snack! Great vegan and gluten free options. Had a DELICIOUS crepe with dark chocolate and strawberries…100% GF and vegan. It was 12/10❣️ Also had the Gold Coast smoothie and added pea protein powder (other proteins powder options: whey and hemp.) The menu also had some salads and savory crepes for an actual meal. We will definitely be back!
April 27 · Gabby ZeaglerI’ve been coming here for years before they upgraded the store and it was just counter service and a few chairs up against the windows.The quality is consistently greatThe staff always kind.Love this shop the Bensonhurst savory crepe and the sheepshead sweet one are my favorites. Green mango is my go to smoothie.I always try to spread the word to people about this place. I hope they remain a staple in the area for a long long time.
January 19 · Coi Joi
More restaurants near me

710 Fulton St, Brooklyn, NY 11217, USA

109 S Portland Ave, Brooklyn, NY 11217, USA

706 Fulton St, Brooklyn, NY 11217, USA

698 Fulton St, Brooklyn, NY 11217, USA

694 Fulton St, Brooklyn, NY 11217, USA

690 Fulton St, Brooklyn, NY 11217, USA

781 Fulton St, Brooklyn, NY 11217, USA

781 Fulton St, Brooklyn, NY 11217, USA

5 Greene Ave, Brooklyn, NY 11238, USA

1 Greene Ave, Brooklyn, NY 11238, USA

773 Fulton St, Brooklyn, NY 11217, USA

7 Greene Ave, Brooklyn, NY 11238, USA
Categories
Top Visited Sites






Trending Dining Insights Posts





