Meme's Healthy Nibbles Introduce
Looking for a fantastic spot in Brooklyn that offers delicious, wholesome, and varied menu options from morning till night? Look no further than Meme's Healthy Nibbles. This beloved local establishment on Nostrand Avenue has quickly become a go-to destination for New Yorkers seeking a healthier spin on classic comfort food, alongside an impressive selection of fresh juices, smoothies, and top-tier coffee. More than just a cafe, Meme's Healthy Nibbles is a true community hub, proudly identifying as both a Black-owned and women-owned business.
Meme's manages to blend a relaxed, casual, and cozy atmosphere with a trendy edge, making it a comfortable and inviting place for everyone. Whether you’re kicking off your day with a hearty breakfast, powering through a remote work session, or meeting friends for a late-night bite, Meme's delivers. The extensive menu showcases a commitment to providing high-quality, organic dishes and caters wonderfully to various dietary preferences, featuring abundant vegan and vegetarian options without sacrificing flavor or satisfaction. It’s the perfect blend of a dedicated **Cafe**, a vibrant **Brunch restaurant**, a delightful **Creperie**, a satisfying **Hamburger restaurant**, a refreshing **Juice shop**, and a classic **Pancake/Sandwich shop** all rolled into one.
From their signature warm bowls and stacked pancakes to their gourmet burgers and creative crepes, every dish is crafted with care. Customers consistently rave about the friendly, helpful service—attributing the welcoming experience to the genuine "Mom and Pop in ALL the BEST ways" feel. It’s a place where quality food meets kindness, epitomized by staff members like David, who make sure even the "tough customers" leave happy.
Meme's Healthy Nibbles is conveniently situated in the heart of Brooklyn, making it easily accessible for local residents and visitors alike.
The exact location is: 707 Nostrand Ave, Brooklyn, NY 11216, USA.
Being right on Nostrand Avenue, the cafe is well-connected by public transit and is a central fixture in the neighborhood.
The establishment takes accessibility seriously, ensuring a comfortable experience for all patrons. The location features a Wheelchair accessible entrance, Wheelchair accessible restroom, and Wheelchair accessible seating, demonstrating a commitment to serving the entire community.
For those who prefer a different dining experience, Meme's offers various service options, including Dine-in, Takeout, and Delivery, with the added option of No-contact delivery for maximum convenience and safety.
Meme's Healthy Nibbles provides a comprehensive range of dining and amenity services to meet the diverse needs of their New York clientele.
- Full Menu Dining: Available for Breakfast, Brunch, Lunch, Dinner, and Dessert.
- Flexible Service Options: Includes Dine-in (with Seating and Table service), Takeout, Delivery, and No-contact delivery.
- Reservations: The establishment Accepts reservations, making it easy to plan your visit, especially for Groups.
- Connectivity: Wi-Fi is provided, making it Good for working on laptop.
- Family & Pet Friendly: The cafe is Good for kids and offers High chairs. They also welcome Dogs allowed outside.
- Amenities: Features a standard Restroom and a Gender-neutral restroom.
- Payment Options: Accepts multiple forms of payment, including Credit cards, Debit cards, and NFC mobile payments.
What truly sets Meme's Healthy Nibbles apart are the specific highlights and offerings that have earned them a stellar local reputation in Brooklyn.
- Exceptional Beverage Selection: Customers frequently praise the Great coffee, Great dessert, and particularly the Great tea selection—including potent, healthy concoctions like “The Knockout - Flu And Cold Fighter Tea.”
- Health-Focused & Dietary Inclusivity: The menu is rich in Healthy options, Organic dishes, Vegan options, and Vegetarian options, ensuring everyone can find something delicious. Highlights include the acclaimed Buddha Bowl, various Tofu Scrambles, and numerous fresh Organic Juices and All Natural Smoothies.
- Comfort & Variety: The cafe offers the perfect balance, featuring classic Comfort food alongside lighter fare. This includes everything from gourmet Charcoal Grill Burgers (like the 'I Am Amazing - Veggie Burger' and 'I Am Best - Wild Salmon Burger') to sweet and savory Crepes.
- All-Day Appeal: It's a top choice for all meals, being Popular for Breakfast, Lunch, Dinner, and even Late-night food, offering satisfying options at any time.
- Solo & Remote Work Friendly: The Casual, Cozy, and Trendy atmosphere, combined with available Wi-Fi and an acceptance of Solo dining, makes it an ideal place to settle in and work.
Ready to stop by for a smoothie, a brunch platter, or a delicious warm bowl? Here is how you can get in touch with Meme's Healthy Nibbles.
Address: 707 Nostrand Ave, Brooklyn, NY 11216, USA
Phone: (718) 493-1375
For direct mobile contact, you can also reach them at +1 718-493-1375.
If you're in the New York area, particularly Brooklyn, Meme's Healthy Nibbles is more than just a place to grab a quick bite—it's an experience. The unparalleled menu variety truly offers something for every craving and every time of day. Where else can you find a full menu that excels at everything from a perfectly cooked Western Omelette and a stack of Pancakes to a gourmet Wild Salmon Burger and a fresh-pressed 'I Am Alive' Green Juice? The availability of Vegan Gluten Free Breakfast Pastries and desserts, such as the Vegan Gluten Free Carrot Walnut Muffin, showcases their dedication to accommodating modern dietary needs without compromising on flavor or indulgence.
Choosing Meme's means choosing a local business that prioritizes community, health, and exceptional service. It's an establishment where the food is consistently praised—from the fantastic Buddha Bowl to the comforting and savory Sunrise Tofu Scramble Breakfast Burrito—and the staff provides service with genuine kindness and generosity. Whether you need a quick, healthy refuel, a cozy spot to meet friends, or a dependable source for late-night healthy food, Meme's Healthy Nibbles is your premier destination in Brooklyn. Come for the food, and stay for the incredibly welcoming and authentic atmosphere that defines this beloved New York gem.
Meme's Healthy Nibbles Menu
Pancakes and Waffles
- Pancakes Stack Of 3 $12.00
Served with syrup and butter.
- Waffles $10.00
Served with syrup and butter.
- Pancakes Platter $15.00
Choice of 2 pancakes, choice of eggs, choice of bacon or sausage
- Waffle Platter $15.00
Single Waffle, Choice of Eggs, choice of bacon or sausage.
Omelettes and Breakfast Salads
- Sunrise Tofu Scramble Platter $14.50
Tofu, peppers, onions, mushrooms, turmeric and vegan cheese. Served with toast and homefries or grits.
- 3 Eggs Any Style $11.00
Eggs served with homefries, grits or mix greens
- Western Omelette $13.50
Eggs, green peppers, red peppers, onions and cheese. Served with toast and homefries or grits.
- Eggs Florentine Omelette $13.50
Eggs , spinach, tomato and cheese. Served with toast and homefries or grits.
- Veggie Omelette $13.50
Spinach, mushrooms, onions, peppers and tomatoes. Served with toast and homefries or grits.
- Side Of Homefries $5.00
- Side Of Grits $5.00
- Nordic Omelette $14.50
Eggs, smoked salmon, organic baby spinach, cheese
Warm Bowls
- Buddha Bowl $16.00
Moroccan Lentil, Mushrooms,Onions, Bell Peppers, Spinach,Sweet Potatoes, Avocado, Quinoa or rice
- Grilled Chicken Bowl $16.95
Grilled Chicken, Mushrooms, Onions, Bell Peppers, Spinach, Avocado, Quinoa, Rice, Seasoned Fries or Sweet Potato Fries
- Meme's Signature Bowl $15.00
Grilled Veggies: Squash, Zucchini, Onions,Peppers,Baby Spinach, Sweet potatoes,Avocado
- Grilled Wild Salmon Bowl $18.00
Grilled Wild Salmon fillet, Mushrooms, Onions, Bell Peppers, Spinach, Avocado, Quinoa, Brown Rice or Yellow Rice, Seasoned Fries or Sweet Potato Fries
Sandwiches and wraps
- Chipotle Shredded Chicken Sandwich
Chipotle shredded chicken
- I Am Magnificent - Grilled Chicken
Chicken, caramelized onions, tomato, mixed greens and condiment
- I Am Berry Content - Chicken Salad
Chicken salad (chicken, vegan mayo, basil, cranberries and celery), tomato and mixed greens. Served on toasted multigrain bread or gluten free bread.
- I Am Bold - BLT
Turkey Bacon, , vegan bacon or smoked tempeh bacon , mix greens, tomato, avocado and vegan mayo (spicy or plain). Served on toasted multigrain bread, English muffin or gluten free bread.
- Sunrise Tofu Scramble Breakfast Burrito $9.95
Tofu scramble with mushrooms, peppers, vegan cheese
Fresh Organic Juices
- I Am Alive - Ian's Green Juice
Spinach, kale, cucumber, green apple, ginger and lemon
- 1. I Am Energized - Carrot, Apple A Day And Ginger Juice
- 2. I Am Energized - Spinach, Apple A Day And Ginger Juice
- Cleansing Tonic Juice
Beet, carrot, apple and ginger.
- Beach Body Juice
Cucumber, ginger, beet, apple, lemon
- C-Side Juice
Kale, apple, lemon, Orange and ginger.
- Apple Blossom Juice
Kale, cucumber, Apple and ginger.
- Simply Carrot Juice
- Fresh Squeezed Orange Juice
- The Knockout - Flu And Cold Fighter Tea $6.00
Ginger, lemon, cayenne pepper, hot water and honey.
- Create Your Own Juice
- Detox Cider
Apple, Carrot, Ginger, Lemon
- Hangover Helper
Orange, carrot,beet, Lemon, Ginger
- Immune Booster
Carrot, Beet, Orange, Lemon, Ginger, Turmeric
- High BP
Beet,Apple, Cucumber,Ginger
All Natural Smoothies and Shakes
- Strawberry Not Shortcake Smoothie
Strawberry, banana and mango.
- I Am Content Smoothie
Pineapple, mango and cream of coconut.
- Peanut Butter Shake
Banana, peanut butter, nutmeg and milk.
- 1. Mixed Berries, Mango And Ginger Smoothie
- 2. Mixed Berries, Cream Of Coconut And Ginger Smoothie
- Super Antioxidant Smoothie
Mixed berries and banana.
- Brooklynite's Smoothie
Strawberry, mango and pineapple.
- Ms. Debbie's Smoothie $13.00
Banana, pineapple, avocado and kale.
- James Power Shake $13.00
Banana, peanut or almond butter, granola, flaxseed, protein powder and milk.
- Create Your Own Smoothie
- Pineapple Smoothie
Pineapple, kale and banana.
- Almond Butter Shake
- Sea Moss Smoothie $13.00
Pineapple,, Strawberry, Banana, Ginger, Sea Moss
- Green Mango Smoothie
Spinach, Pineapple, Mango
- Pina Colada Smoothie
Pineapple, cream of coconut and pineapple juice. Must be 21 to purchase.
- Gingerberry Mango Smoothie
Mix Berries, Mango, Ginger
- Gingerberry, Cream Of Coconut Smoothie
Mix Berries, Cream of coconut, Ginger
- Antioxidant Smoothie
Mix Berries, banana
Cold Drinks
- Organic Cranberry Ginger Lemonade $5.00
- San Pellegrino $2.75
- Poland Spring Water $1.50
- Essentia Water $3.00
Water
- Lacroix Sparkling Water $2.00
- Organic Ginger Lemonade $5.00
- Organic Lemonade $4.00
Lemonade
- Organic Arnold Palmer $5.00
Iced tea and lemonade
- Pineapple Ginger Mocktail $6.50
Fresh ginger, pineapple juice
- Organic Cucumber Lemonade $5.00
Cucumber lemonade
Coffee and Drinks
- Fresh Brewed Coffee (Available Till 3pm)
- Organic Tea
- Ht Chocolate
- Cold Brew Coffee
- 2 Oz. Espresso Double Shot $3.50
- Americano
- Macchiato $3.75
3oz.
- Cortado $4.00
5oz
- Cappuccino $4.50
10oz
- Latte $4.50
12oz
- Mocha Latte $5.50
12oz
- Iced Americano $4.75
- Iced Latte $5.00
16oz
- Iced Mocha Latte $5.75
16oz
- Iced Mocha Frappe
- Chai Latte
Classic Chai Latte
- Iced Chai Latte
- Matcha Latte
Green Tea Matcha Latte
- Iced Matcha Latte
Green Tea Matcha
Fresh Organic Egg and Breakfast Sandwiches
- Egg And Cheese Sandwich $7.50
Served on toasted multigrain bread, English muffin, gluten free bread, bagel or brioche bun
- Bacon, Egg And Cheese Sandwich $9.50
Served on toasted multigrain bread, English muffin, gluten free bread, bagel or brioche bun
- Sausage (Turkey), Egg And Cheese Sandwich $9.50
Served on toasted multigrain bread, English muffin or gluten free bread.
- Spinach, Egg And Cheese Sandwich $8.50
Served on toasted multigrain bread, English muffin or gluten free bread.
- Egg, Avocado And Tomato Sandwich $8.50
Served on toasted multigrain bread, English muffin or gluten free bread.
- Egg And Avocado Sandwich $7.50
- Breakfast Burrito $11.50
Eggs, black beans, jalapeno, bacon or sausage ,cheese in a wrap with spicy or plain mayo
- Egg Sandwich $6.00
- Egg And Turkey Sausage $7.50
- Side Of Homefries $5.00
Homefries
- Side Of Grits $4.50
Grits
- Egg And Bacon $7.50
Egg and bacon
Organic Salads
- I Am Wholesome Salad $13.00
Mixed greens, shredded carrots, avocado, cucumber, beet salad and tomatoes. Served on side with meme's homemade balsamic vinaigrette.
- I Am Blessed - South West Salad $13.00
Southwest mix (corn, black beans, red peppers, red onion and cumin), avocado, tomatoes and mixed greens. Served on side with meme's homemade balsamic vinaigrette.
- I Am Magnificent - Grilled Chicken Salad $15.00
Grilled chicken, mixed greens, avocado, cucumber, shredded carrots, beet salad and tomatoes. Served on side with meme's homemade balsamic vinaigrette.
I Am Perfect Sides
- Avocado $2.50
- Cheese $2.00
- Bacon
- Smoked Tempeh Bacon $3.00
- Regular Seasoned Fries $5.50
- Sweet Potato Fries $5.75
- House Salad $5.00
Mix greens, cucumbers, carrots, tomatoes
Charcoal Grill Burgers and Perfect Sides
- I Am Amazing - Veggie Burger $9.95
- I Am Great - Angus Grass Fed Beef Burger $10.50
- I Am Best - Wild Salmon Burger $10.50
- Grilled Veggies $6.00
Mushrooms,onions, zucchini, squash, bell peppers
Sweet & Savory Crepes
- Nutella Crepe $9.00
- Banana Nutella Crepe $11.00
- Strawberry Nutella Crepe $11.00
- Blueberries, Strawberries & Nutella Crepe $13.00
- Banana, Strawberry & Nutella Crepe $13.00
- Mushrooms, Cheese & Caramelized Onions Crepe $13.00
- Tomato, Mushrooms, Spinach & Caramelized Onions Crepe $14.00
- Grilled Chicken, Caramelized Onions, Spinach & Mushrooms Crepe $16.00
- Create Your Own Crepe $9.00
- Egg Spinach And Cheese Crepe $13.00
Egg Spinach cheese crepe
Soups
- Soup
vegetarian lentil
All New Desserts and Pastries: Life is Short, Eat Dessert!
- Mango And Passion Fruit Eclair $6.00
Traditional French Pastry. Choux filled with mango & passion fruit cream , topped with a mango glaze
- Paris Brest Eclair $7.00
Traditional French pastry. Choux filled with praline cream
- Key Lime Chessecake $7.50
A graham cracker base topped with New York cheesecake with a splash of keylime, decorated with key lime glaze
- Pear Tartlet $8.00
Puff pastry covered with a layer of almond cream topped with pear slices
- Red Velvet Cake $9.00
Red velvet with cream cheese frosting
- Chocolate Cake With Frosting $9.00
Chocolate Cake with Frosting
- Gluten Free Carrot Cake $9.00
Alternating layers of gluten free carrot cake spiced with cinnamon, chopped walnuts and pineapple and smooth cream cheese icing topped with chocolate curls
Vegan Gluten Free Breakfast Pastries and desserts
- Vegan Gluten Free Carrot Walnut Muffin With Frosting $5.50
Vegan Gluten Free Muffin
- Vegan Gluten Free Banana Blueberry Muffin $5.50
Vegan GF muffin
- Vegan Gluten Free Lemon Almond With Frosting Loaf $6.00
Vegan Gluten Free lemon almond loaf
Meme's Healthy Nibbles Details
From the business
- Identifies as Black-owned
- Identifies as women-owned
Service options
- No-contact delivery
- Delivery
- Takeout
- Dine-in
Highlights
- Great coffee
- Great dessert
- Great tea selection
Popular for
- Breakfast
- Lunch
- Dinner
- Solo dining
- Good for working on laptop
Accessibility
- Wheelchair accessible entrance
- Wheelchair accessible restroom
- Wheelchair accessible seating
Offerings
- Coffee
- Comfort food
- Healthy options
- Late-night food
- Organic dishes
- Quick bite
- Vegan options
- Vegetarian options
Dining options
- Breakfast
- Brunch
- Lunch
- Dinner
- Dessert
- Seating
- Table service
Amenities
- Gender-neutral restroom
- Restroom
- Wi-Fi
- Wi-Fi
Atmosphere
- Casual
- Cozy
- Trendy
Crowd
- Groups
Planning
- Accepts reservations
Payments
- Credit cards
- Debit cards
- NFC mobile payments
- Credit cards
Children
- Good for kids
- High chairs
Pets
- Dogs allowed outside
Meme's Healthy Nibbles Photos










Meme's Healthy Nibbles Location
Meme's Healthy Nibbles
707 Nostrand Ave, Brooklyn, NY 11216, USA
Meme's Healthy Nibbles Reviews
veganjuicehealthy foodorganicwrapgluten freecrepestempehvegetariansweet potato fries
★ 5★ 4★ 3★ 2★ 1This was a great place for a healthy lunch. We had friendly and helpful service, and it took about 10-15 minutes to get our food. Lots of delicious options on the menu, from smoothies and sandwiches, salads snd warm bowls. I love that they had a large variety of vegan desserts as well. I highly recommend the Buddha bowl!
January 11 · Rachel CorvingtonThis spot is so Mom and Pop in ALL the BEST ways. David took care of us with kindness and generosity. My Mom (a very tough customer ) LOVED her burger and fries and my vegan breakfast burrito was fantastic! David made me “Knockout” Tea: fresh ginger, honey and more potent healthy stuff… so goood! Thank you, David!
August 09 · Lisa ArrindellI don’t know what you’ve been told. But the best gluten free pancakes in nyc can be found HERE! My body forced me into gluten less life 3 years ago and since then I’ve been on the hunt for a gluten free version of my favorite food. After trying everything, including Liehops fluffy pancakes I keep coming back to memes healthy nibbles even though it’s well out of my way. But it’s worth the B44 bus trip. The service was also friendly, and the bathroom was clean
June 19 · Amber WorsleyEchoing what a lot of other reviews have said here – it's great to have places in the neighborhood with menus like this, but it's not worth enduring the really unpleasant staff.EDIT: Just so everyone is aware – despite the owner's response below, no attempt to refund the purchase has been made.
July 30 · Wesley EmblidgeHad a wonderful breakfast here! The chicken mushroom spinach crepe was delicious and flavorful! The chicken was a little dry, but overall, delicious.
January 14 · Cherie B. Tay
More restaurants near me

10 Herkimer St, Brooklyn, NY 11216, USA

1286 Fulton St, Brooklyn, NY 11216, USA

1318 Fulton St, Brooklyn, NY 11216, USA

1318 Fulton St, Brooklyn, NY 11216, USA

1276 Fulton St, Brooklyn, NY 11216, USA

1276 Fulton St, Brooklyn, NY 11216, USA

1309 Fulton St, Brooklyn, NY 11216, USA

1319 Fulton St, Brooklyn, NY 11216, USA

1194 Fulton St, Brooklyn, NY 11216, USA

1194 Fulton St, Brooklyn, NY 11216, USA

1257 Fulton St, Brooklyn, NY 11216, USA

1190 Fulton St, Brooklyn, NY 11216, USA
Categories
Top Visited Sites






Trending Dining Insights Posts





