Bora Bora Smoothie Cafe: A Sweet & Savory Escape in Brighton Beach, Brooklyn

Bora Bora Smoothie Cafe Introduce

Bora Bora Smoothie Cafe Menu

4. Matcha Bowls
Matcha Gotcha $0.00
Matcha - Granola - Strawberry - Blueberry - Mint - Pumpkin Seed - Agave
Matcha Power $0.00
Matcha - Granola - Blueberry - Mix Nut - Almond Butter - Flax Seed - Agave
Matcha Bliss $0.00
Matcha - Granola - Strawberry - Banana - Chia Seed - Maple Syrup
Bora Green $0.00
Matcha - Granola - Strawberry - Kiwi - Lavender - Agave

Waffles
#2 Pistachio Waffle $17.99
A Fresh Decadent Waffle with Pistachio Sauce, with a White & Dark Chocolate Decor. Assorted Fruits; Strawberry, Blueberry, Kiwi, & Banana.
#4 Lotus Waffle $17.99
A Fresh Decadent Waffle with Lotus Sauce, with a White & Dark Chocolate Decor. Assorted Fruits; Strawberry, Blueberry, Kiwi, & Banana.
#3 Dubai Chocolate Waffle $19.19
A Fresh Decadent Waffle with Pistachio Kunafa Filling, Belgium Chocolate, Pistachio Sauce on Top with Pistachio decor. Assorted fruits; Strawberry, Kiwi, Blueberry, & Banana.
Custom Waffle $16.79
#6 Nutella Waffle $17.99
A Fresh Decadent Waffle with Nutella. Assorted Fruits; Strawberry, Blueberry, Kiwi, & Banana.
#1 Bora Bora Waffle $17.99
A Fresh Decadent Waffle with Kinder, Pistachio, & Lotus sections with Dark Chocolate Decor. Assorted Fruits; Strawberry, Blueberry, Kiwi & Banana.
#5 Kinder Waffle $17.99
A Fresh Decadent Waffle with Kinder Sauce, & a Dark Chocolate Decor. Assorted Fruits; Strawberry, Blueberry, Kiwi, & Banana.

Shots
Flu Shot $4.80
Ginger Shot $4.50
Turmeric Shot $4.50

3. Coconut Bowls
Tropical $0.00
Coconut - Granola - Banana - Mango - Blueberry
Cocotella $0.00
Coconut - Granola - Strawberry - Banana - Nutella - Almond
Coco Nut $0.00
Coconut - Granola - Banana - Almond Butter - Coconut Shredded
Very Berry $0.00
Coconut - Granola - Strawberry - Blueberry - Goji Berry - Agave

Signatures
#16 The Maldives $11.99
Strawberry syrup w/slices 7up & Orange juice Blueberry Slush
#20 Fruit Splash $13.19
Sliced Kiwis Vanilla Ice-cream Mango Ice-cream Strawberry Juice
#15 Strawberry Kiss $13.19
Pineapple & Banana pieces Strawberry Juice Vanilla Ice cream w/ Strawberry slices
#8 Beirut $14.39
Assorted Fruits Strawberry & Mango Juice Lebanese cream w/ Nuts&Honey
#10 Aquarium $11.99
7UP w/ Peach&Passion Ice base Mango Juice Raspberries
# 1 Red Rocket $9.59
Raspberry Syrup Vanilla Ice cream Rocket Ice w/ Candy
#21 Bora Bora $11.99
Mango Juice (Blended w/ Strawberries & Kiwi) Avocado Juice Nuts&Honey on top
#23 YoYo $14.39
Vanilla Ice cream w/ pistachio powder Strawberry w/ Banana juice Whipped Cream Mango&Strawberry decor
#17 Ice Vimto $11.99
Raspberry syrup Vimto w/ Crushed ice Vanilla Ice cream w/ crumbled raspberries
#22 Unicorn $14.39
Strawberry & Mango Vanilla base Mango ice cream Coated Sugar cone w/ Strawberry syrup Pineapple,Mango,Strawberry decor
#24 Fruity Cream $11.99
Honey w/ Rainbow flakes Vanilla Ice cream Fruity Powder
#11 Movie Time $11.99
Popcorn syrup Vanilla Ice cream Caramel sauce w/Popcorn decor
# 7 Harmony $10.79
Vanilla Ice cream Strawberry Juice Mango Juice
#2 Rainbow Rocket $8.39
Blueberry-Strawberry-Mango Slush Rocket Ice
#3 Blue Rocket $9.59
Blueberry Syrup Vanilla Ice cream- Rocket Ice w/ Candy
#14 Candy Cloud $13.19
Vanilla Ice cream Bubble-Gum syrup Cotton Candy
#18 Mango Tango $11.99
Mango Juice Vanilla Ice cream Raspberries
#13 Dreamy Creamy $14.39
Vanilla ice cream w/ Strawberry syrup Orange & Peach ice base Rocket ice w/ Peach rings
#9 Avocado Boost $14.39
Avocado Juice Lebanese cream w/ Nuts&Honey Strawberry Decor
#4 Strawberry Shortcake $13.19
Strawberry Juice Vanilla Ice cream Cheesecake syrup Lotus biscuits
#6 Berrylicious $11.99
Vanilla Ice cream Strawberry juice Raspberries
#19 Cosmic Jam $14.39
Banana & Fruit salad Mango & Strawberry Juice Vanilla Ice cream w/ Swiss cake roll Pineapple-Mango-Strawberry decor
#5 Sweet Tooth $13.19
Mango-Strawberry-Blueberry Slush Vanilla Ice cream Peach rings & Popping candy
#12 Terminator $14.39
Bananas w/ Mango & Avocado Juice Vanilla Ice cream Mango&Kiwi decor w/ Nuts&Honey

2. Pitaya Bowls
Tampa $0.00
Pitaya - Granola - Pineapple - Mango - Mint - Agave
Hawaiian $0.00
Pitaya - Granola - Strawberry - Blueberry - Kiwi - Coconut Flake
Sweet Sweet $0.00
Pitaya - Granola - Strawberry - Banana - Nutella - Cocoa Nibs
Coconut Dream $0.00
Pitaya - Granola - Banana - Pineapple - Coconut - Maple Syrup

Refresher
Strawberry Refresher $7.69
A vibrant strawberry drink, topped with real strawberries and ice.
Mango Oat Refresher $7.19
A Smooth Mellow Mango Refresher with Creamy body of Oatmilk
Lychee Refresher $7.69
A refreshing lychee blend, shaken with water, ice, and a burst of fresh orange slices.
Pomegranate Refresher $7.69
A bold pomegranate delight, chilled with ice and fresh mint for a perfect cool-down.

Hot Coffee
Espresso $0.00
Chai Latte $0.00
Mocha $0.00
Hot Chocolate $0.00
Cortado $4.79
96oz Coffee Box $32.39
Matcha Latte $0.00
Spanish Latte $0.00
Brown Sugar Oat Milk Latte $0.00
Tea $0.00
Cafe Latte $0.00
Americano $0.00
Drip Coffee $0.00
Cappuccino $0.00

1. Açaí Bowls
4. Boraklyn $0.00
Açaí - granola - strawberry - banana - cashew butter - chia seed - honey
1. Bora Berry Açai $0.00
Açaí - Granola - Strawberry - Blueberry - Banana - Goji Berry - Honey
2. Bora Nut $0.00
Açaí - granola - banana - pumpkin seed - almond butter - walnut - flaxseed - honey
3. Boratella $0.00
Açaí - granola - strawberry - peanut butter - banana - nutella - cocoa nibs - agave

Iced Coffee
Strawberry & Cream Matcha $0.00
A Rich Strawberry sweet cream base with a smooth & balanced body of ceremonial matcha
Iced Americano $0.00
Iced Matcha $0.00
Iced Pistachio Latte $0.00
A Handcrafted Latte with a rich Pistachio notes & Pistachios.
Iced Caramel Frappuccino $0.00
Iced Chai Latte $0.00
Iced White Mocha Frappuccino $0.00
Blueberry & Cream Matcha $0.00
A Rich Blueberry sweet cream base with a smooth & balanced body of ceremonial matcha
Iced Spanish Latte $0.00
Iced Mocha $0.00
Iced Tiramisu Latte $0.00
A Handcrafted Latte with tiramisu & Cacao notes with a Mascarpone cold foam
Iced Shaken Matcha $0.00
Iced Lotus Latte $0.00
A Handcrafted Latte with Rich Nutty & Cookie butter notes.
Mango & Cream Matcha $0.00
A Rich Mango sweet cream base with a smooth & balanced body of ceremonial matcha
Iced Shaken Espresso $0.00
Iced Latte $0.00
Iced Brown Sugar Oat Milk Shaken Espresso $0.00
2 shot of espresso. Brown sugar . Cinnamon. *Oatly milk recommended*
Iced Caramel Macchiato $0.00
Iced Coffee $0.00

Beverages
Strawberry Freez Bottle $2.99
Redbull $3.59
Tropical Freez Bottle $2.99
Diet Red Bull $3.59

Sweet Croffles
#14 Blueberry Cream Cheese Croffle $7.19
#16 Strawberry Cream Cheese Croffle $7.19
Cream cheese. - strawberry jam. - strawberry
#15 Kinder Croffle $7.19
#17 Peanut-Butter Banana Croffle $7.19
#13 Nutella Custard Croffle $7.19
Nutella - cream cheese - strawberry
Lotus Croffle $7.19
Custom Croffle $5.99

Crepes
#4 Lotus Crepe $14.39
Crepe Lotus Sauce Kinder Sauce Dark Chocolate Biscoff crumbs
#7 Mini Pancake $10.79
Mini Pancakes Belgium Chocolate Dark Chocolate
Dubai Chocolate Crepe $16.79
#5 Pistachio Crepe $14.39
Crepe Pistachio Sauce White Chocolate Dark Chocolate Pistachio Powder
#3 Kinder Crepe $14.39
Crepe Kinder Sauce Dark Chocolate Kinder-Bar
#2 Bora Bora Crepe $17.39
Crepe Strawberry & Banana Slices Nutella Inside Sections of Sauces Lotus-Pistachio-Kinder
#1 Nutella Crepe $14.39
Crepes Sliced Strawberries Nutella
#6 Mini Crepe $11.99
Mini Crepes Belgium Chocolate Kinder Sauce

6. Custom Bowls
Custom Bowl $0.00

5. Mango-Pineapple Bowls
#3 Island Vibe $0.00
A refreshing vibrant bowl of silky mango-pineapple sorbet, with complimentary assorted toppings Mango Pineapple - Granola - Blueberry - Kiwi - Chia Seed - Coconut Flake
#1 Paradise $0.00
A refreshing vibrant bowl of silky mango-pineapple sorbet, with complimentary assorted toppings Mango Pineapple - Granola - Strawberry - Blueberry - Goji Berry - Agave
#2 Sunny Days $0.00
A refreshing vibrant bowl of silky mango-pineapple sorbet, with complimentary assorted toppings Mango Pineapple - Granola - Mango - Pineapple - Coconut Flakes - Bee Pollen
#4 Mango Delight $0.00
A refreshing vibrant bowl of silky mango-pineapple sorbet, with complimentary assorted toppings Mango Pineapple - Granola - Mango - Mixed Nuts

Ice Cream
Unicorn Ice-Cream $7.25
Vanilla Ice-Cream $6.04
Kinder Ice-Cream $6.04
Slush $4.99
Nutella Ice-Cream $6.04
Lotus Ice-Cream $6.04
Strawberry Ice-Cream $6.04
Mango Ice-Cream $6.04
Pistachio Ice-Cream $6.04

Juices
Energy $0.00
Orange, Spinach, Beet, Apple, Carrot
Red&Green $0.00
Kale Spinach Beet Apple
A.B.C $0.00
Apple Beet Carrot
Euphoria $0.00
Spinach kale Apple orange
Bora Power $0.00
Orange Carrot Pineapple Ginger
Lemonade $0.00
Green Health $0.00
Kale Spinach Celery Apple Cucumber
Ginger Spark $0.00
Simple $0.00
Apple- Orange
Colon Detox $0.00
Tropical Mood $0.00
Orange Juice Pineapple Juice Apple Juice
Heart Beat $0.00
Beets Carrots Oranges

Dubai Chocolate Trends
Dubai Chocolate Bar $0.00
Dubai Strawberry Cup $17.99
Strawberry Dipped with Dubai Chocolate Kunafa.

Smoothies
Nitro $0.00
Spinach Kale Mango Banana Spirulina & Vegan Protein
Sunshine $0.00
Banana Mango Pineapple
Pick-Me-Up $0.00
Strawberry Banana Mango
Lean-Machine $0.00
Peanut butter Banana Cocoa Powder
Watermeon Sugar-High $0.00
Watermelon Strawberry Juice Lemon Mint
Flourish $0.00
Kale Spinach Banana Flax seeds Orange juice
Mellow-Mango $0.00
Mango Peach Banana
Mocha-Haze $0.00
Peanut Butter Banana Chocolate Protein Espresso
Pina-Colada $0.00
Pineapple Mango Coconut Banana
Bora-Berry ++ $0.00
Strawberry Banana Orange juice Vanilla Ice Cream Honey

Crafted Sandwiches
C-Olive Halloumi Delight $8.39
Halloumi - Black Olives - Cherry Tomatoes - Fresh Mint - Oregano - Cucumber
B-Gourmet Egg Sandwich $8.39
Scrambled Eggs - Tomatoes - Cheddar Cheese - Avocado
A-Classic Feta Fusion $8.39
Fresh feta, chopped seedless tomatoes Olive oil, oregano, mint Arugula garnish

Soft/Energy Drinks
#28 Candy Crush $10.59
Candy Mix: Peach Rings-Sour Worms-Strawberry Bubbles Red-Bull Cotton candy & Popping candy
#29 Soft Passion $9.39
Crushed Ice Red-Bull/7UP Lemon & Mint
#27 EL-Toro $9.39
Vimto Crushed Ice Rocket Ice
#31 Sunset $9.39
Fruit syrup Crushed ice Lemon & mint Redbull/7up
#30 Droplet $9.39
Tropical Syrups Crushed Ice Red-Bull Lemon & Mint
#33 Blue Lagoon $9.39
Fruit syrup Crushed ice Lemon & mint Redbull/7up
#32 Pink Ace $9.39
Strawberry Slices 7UP/Redbull Lemon & Mint

Power Smoothies
Dragon $0.00
Dragon fruit, coconut flakes, banana, coconut water
Acai Breeze $0.00
AcaÌ Banana Blueberry Almond butter Almond milk
Nut Nut $0.00
Walnut, banana, Chia seeds, peanut butter, cinnamon, protein
Blue Moon $0.00
Blue Spirulina, banana, pineapple, coconut flakes, apple juice
Oatly $0.00
Banana, oat, spinach, blueberry, yogurt
Nitro $0.00
Green Spirulina ,Spinach, kale, banana, mango, vegan protein
Mocha Haze $0.00
Peanut butter, banana, espresso, chocolate protein
Matcha Green $0.00
Matcha, spinach, kale, chia seed, banana, agave
Date $0.00
Date, granola, cinnamon, flaxseeds, banana, almond butter, oat milk

Savory Croffles
#9 Halloumi $9.59
Grilled Halloumi Olive slices-Cucumbers Basil pesto Arugula Mayo
#10 Smoked Turkey $9.59
Smoked Turkey Lettuce Tomato Avocado Mayo&Mustard
#8 Labna Zatar $9.59
Labna Zatar Cucumber Tomato Mint
Croffle $5.99
#12 Egg Benedict $9.59
Egg&Cheese Avocado Tomato
#11 Smoked Salmon $9.59
Salmon Cream Cheese Sliced Lemon Capers Dill

Platters
#18 Strawberry Stick $7.19

Milkshakes
#2 Oreo MilkShake $0.00
#3 KitKat MilkShake $0.00
Strawberry Milkshake $0.00
#8 Kinder Bueno MilkShake $0.00
#10 Mango MilkShake $0.00
#12 Banana MilkShake $0.00
#1 Pistachio MilkShake $0.00
Vanilla Milkshake $0.00
#4 Nutella MilkShake $0.00
#5 Lotus Biscoff MilkShake $0.00
#6 Mocha MilkShake $0.00
#9 Coffee MilkShake $0.00
#7 Snickers MilkShake $0.00

Bora Bora Smoothie Cafe Details

Service options
Delivery
Takeout
Dine-in

Offerings
Coffee
Quick bite

Dining options
Breakfast
Brunch
Lunch
Dinner
Dessert
Seating

Atmosphere
Casual

Parking
Free street parking
Paid street parking

Bora Bora Smoothie Cafe Photos

Bora Bora Smoothie Cafe Location

Bora Bora Smoothie Cafe

New York Kings County Brighton Beach Brighton Beach Avenue

516 Brighton Beach Ave, Brooklyn, NY 11235, USA

Bora Bora Smoothie Cafe Reviews

An average rating of ★4.8 from 419 user reviews.

dessertcrepesaçaí bowldesertwafflepricecashiermilkshakelagoonpistachio crepe

★ 5★ 4★ 3★ 2★ 1

Here's a one-star review based on your feedback:Absolutely Awful - Avoid at All CostsI've never experienced such terrible service in my life. I stood at the counter for over five minutes, completely ignored by the staff, even though the place was practically empty. The wait for food was even worse—it took a shocking 18 minutes to get a simple order ready, and then even longer for a single cappuccino.The state of this place is disgusting. The tables were visibly dirty despite there being no other customers. And don't even get me started on the bathroom—it was full of roaches, and there was no paper towel or air dryer. The food was just "okay," but it's not worth the horrific experience.This place is a complete disaster. Save yourself the trouble and money and go anywhere else. Yuck!
September 17 · Eli Brown
I truly think it’s wonderful to have places like this especially after COVID, when there just weren’t many spots like Bora Bora Café to go to. The dessert was absolutely delicious fresh, flavorful, and the fact that it’s halal makes it even better. It’s so nice to have somewhere you can go for a sweet treat or snack, or bring friends and family to enjoy a warm, inviting hangout vibe.
September 20 · shura
What a great spot! The staff at Bora Bora are fantastic-so welcoming, kind, and genuinely helpful. They made my visit a pleasure. Not only was the service incredibly quick, but the dessert and drink I had were fresh and absolutely delicious. This is my new favorite place for a sweet treat
August 02 · Madina Cruz
I cane here with my two kids m, while we waited for our laundry to wash, the wait was a little long but it’s understandable since it’s brand new and a lot of people were dropping in to try. Two of the smoothies didn’t have the adjustments u made but they kindly remade it and were very kind and welcoming. This was a great quick smoothie place while we did our laundry. The seating was comfortable and the atmosphere were very relaxing and chill. I don’t ever rite reviews but they were very kind in correcting my order so I felt that the least I could do to appreciate was write a review of my experience, can’t wait to see this place flourish more as u see they have a another food area in the back that is a work in progress still, btw the smoothies were really good and refreshing thank you
July 13 · Cristina Sanchez
Amazing place! The juices are super fresh and full of flavor. The staff is very friendly, and the service is fast. Highly recommend Bora Bora for anyone who loves delicious and refreshing drinks!
August 23 · 8dooRi 12