Daily Spot Cafe Introduce
For New Jersey diners seeking an authentic taste of South America, the **Daily Spot Cafe** in Kearny offers a unique and welcoming destination. Far from a typical American diner, this establishment is a dedicated **Ecuadorian restaurant**, bringing the rich, comforting, and flavorful cuisine of Ecuador right to Kearny Avenue. It serves as a true local gem, providing a casual, cozy atmosphere where the community—especially locals and families—can gather for a satisfying meal any time of the day.
The cafe is built on strong community values and proudly identifies as both **Black-owned** and **women-owned**, offering a distinct and important presence within the local New Jersey business landscape. It’s a place where authentic, traditional dishes take center stage. While the menu caters to all major meal times, from **Breakfast** through **Dinner**, the core appeal lies in the genuine Ecuadorian offerings. Customers consistently rave about staples like the delicious **ceviche** (often served with fish or shrimp, tomatoes, onions, and lemon juice) and hearty **bolones** (fried green plantain dumplings, often mixed with cheese or pork cracklings, known as chicharrón). This spot is perfect for those looking for genuine flavors, hearty portions of **Comfort food**, and a reliable quick meal or leisurely dining experience.
---
## Location and Accessibility
The **Daily Spot Cafe** is conveniently situated at **247 Kearny Ave, Kearny, NJ 07032**, placing it right on a main thoroughfare in the bustling Kearny community. This central location makes it easily reachable for patrons from surrounding New Jersey neighborhoods looking for high-quality, authentic Ecuadorian cuisine. Its street-level presence ensures it is a prominent spot for passing foot traffic and those driving to the area.
Regarding accessibility and parking, the cafe offers several convenient options to accommodate its diverse clientele. Parking is made relatively easy with access to a **Free parking lot** as well as both **Free street parking** and **Paid street parking** options available nearby. The dining environment itself is designed for comfort, offering a **Casual** and **Cozy** ambiance. While specific notes on wheelchair accessibility are not provided, the ground-floor presence on a main street generally makes it accessible for most patrons. The focus is on providing a comfortable, welcoming experience for everyone, from **Locals** grabbing a coffee to **Family-friendly** groups settling in for a meal.
---
## Services Offered
The Daily Spot Cafe provides a full array of services that cater to modern dining preferences, ensuring you can enjoy their authentic food wherever you prefer—in the cafe or in the comfort of your own home. The flexibility in service options is a major draw for busy New Jersey customers:
- **Flexible Dining:** Patrons have the choice of a relaxed **Dine-in** experience with comfortable **Seating** and **Counter service**, or they can opt for convenience with **Takeout**, **Delivery**, and **Curbside pickup** options.
- **Full Meal Coverage:** The cafe operates throughout the day, offering meals from the first bite of the morning with **Breakfast** and **Brunch**, to **Lunch** and **Dinner**, including delightful options for **Dessert**.
- **Catering Services:** For larger gatherings, the cafe provides dedicated **Catering** services, allowing you to bring the authentic flavors of Ecuadorian comfort food to your next event.
- **Payment Convenience:** The cafe accepts modern payment methods, including major **Credit cards**, **Debit cards**, and **NFC mobile payments**, ensuring a quick and hassle-free transaction.
- **Family-Focused Amenities:** The cafe is **Good for kids**, offering both a specific **Kids' menu** and **High chairs** to comfortably accommodate families dining in.
- **Coffee Focus:** A highlight is the dedicated coffee service, providing fresh **Coffee** options perfect for starting your morning or enjoying with dessert.
---
## Features / Highlights
What makes the Daily Spot Cafe a standout in the Kearny dining scene is the fusion of high-quality cuisine with its distinct identity and welcoming environment. The following are key features and highlights:
- **Exceptional Coffee:** The cafe is specifically highlighted for having **Great coffee**, a crucial feature for any morning routine or afternoon pick-me-up.
- **Authentic Comfort Food:** The menu is centered on delicious **Comfort food**, featuring traditional Ecuadorian specialties like various types of **Bolones** and seafood dishes such as **Ceviche**. It’s the ideal place for a filling and satisfying meal.
- **Dietary Versatility:** The menu offers simple, satisfying options like **Quick bite** items and **Small plates**, making it adaptable for various appetites and schedules.
- **Diverse Meal Popularity:** The cafe is highly **Popular for Breakfast, Lunch, and Dinner**, confirming its ability to serve delicious food consistently throughout the day. It is also a well-loved choice for **Solo dining**.
- **Inclusive Ownership:** The cafe proudly identifies as both a **Black-owned** and **women-owned** business, offering a unique opportunity for the community to support diverse local entrepreneurship.
- **Welcoming Crowd:** The atmosphere is consistently described as **Casual** and **Cozy**, attracting a crowd of **Locals** and being highly **Family-friendly**, fostering a sense of community.
---
## Contact Information
To place an order for pickup, inquire about the menu, or arrange catering for an upcoming event, please contact the **Daily Spot Cafe** using the following details:
- **Address:** 247 Kearny Ave, Kearny, NJ 07032
- **Phone:** (862) 403-8853 or +1 862-403-8853
---
## What is Worth Choosing
For New Jersey residents, **Daily Spot Cafe** represents a vibrant cultural and culinary anchor, offering a much-needed break from the usual dining options. What is truly worth choosing here is the authenticity and quality of the Ecuadorian cuisine coupled with the warm, community-focused service. Customers repeatedly praise specific menu items like the delicious **ceviche** and **bolones**, highlighting the reasonable prices and wonderful service they receive, solidifying its reputation as a local "gem."
While an occasional customer may experience a hiccup with order specifications or wait times—which is a reality of any busy, high-quality restaurant, as illustrated by one review regarding a miscommunication about the protein accompanying the mote pillo—the overall consensus and the strong array of positive features outweigh these isolated incidents. The cafe’s dedication to providing genuine, hearty food, even as a small business, is clear. The mote pillo itself is a traditional Ecuadorian dish of hominy corn sautéed with eggs, onions, and spices, typically served with sides that vary by region, and the cafe’s ability to offer this and other regional specialties like various soups and stews is a testament to its authentic roots.
Choosing **Daily Spot Cafe** means supporting a local, **Black-owned, women-owned** business that is committed to delivering flavorful **Comfort food** for **Breakfast, Lunch, and Dinner**. The combination of a cozy atmosphere, convenient service options (including **Curbside pickup** and **Delivery**), and genuine Ecuadorian cooking makes it an essential stop on Kearny Avenue for anyone seeking a unique and satisfying culinary experience in New Jersey.
Daily Spot Cafe Details
From the business
- Identifies as Black-owned
- Identifies as women-owned
Service options
- Curbside pickup
- Delivery
- Takeout
- Dine-in
Highlights
- Great coffee
Popular for
- Breakfast
- Lunch
- Dinner
- Solo dining
Offerings
- Coffee
- Comfort food
- Quick bite
- Small plates
Dining options
- Breakfast
- Brunch
- Lunch
- Dinner
- Catering
- Counter service
- Dessert
- Seating
Amenities
- Restroom
Atmosphere
- Casual
- Cozy
Crowd
- Family-friendly
- Locals
Payments
- Credit cards
- Debit cards
- NFC mobile payments
- Credit cards
Children
- Good for kids
- High chairs
- Kids' menu
Parking
- Free parking lot
- Free street parking
- Paid street parking
- Parking
Daily Spot Cafe Photos










Daily Spot Cafe Location
Daily Spot Cafe Reviews
encebolladopricehumitasecoempanadasfishsteakcevichegemspeaking
★ 5★ 4★ 3★ 2★ 1I walked in to this place, after me 2 groups of people walked in. I waited more than 30 minutes for my mote pillo..both groups were served and atiendes before me.. this dish is supposed to come with beef.. after the wait, I brought my food home. I can’t eat pork and was very specific that I wanted beef with it. I paid $17 for this.. Im dissapointed. It’s Just not fear.
August 09 · Ines DávilaThe ceviche and bolones are delicious. They also have fresh squeezed orange juice for the kids. Very reasonable prices and wonderful service. Definitely stop by this gem in the Jersey City area!
March 22 · Brian Sterling ChanThe owner is so nice! And the food is amazing.
May 30 · Teto RodríguezA hot small place with no light on a summer Sunday. You can see the dirty bowl of soup with dried drops on the outside. The fish soup has old chopped cilantro that could be dropped into the trash.I just wonder why did I stopped there?But, for many people that is not a problem at all.Also the prices are just like the ones at a good Ecuadorian restaurant. Like Garcia’s on Union City.
July 07 · S.I. GeneralThis Ecuadorian restaurant is a true gem! Every dish, from the hearty llapingachos to the rich seco de pollo, bursts with authentic flavors and passion. The warm, welcoming staff and cozy atmosphere make each visit feel like a trip to Ecuador. If you’re craving a genuine taste of Ecuadorian culture, this spot is a must-try! ♥️♥️🫶
November 06 · Juana Yánez
More restaurants near me
Consigliere4.0 (60 reviews)31 Warren St, Newark, NJ 07102, USA
Crown Fried Chicken4.0 (108 reviews)64 Franklin St, Belleville, NJ 07109, USA
Masagana Enterprises Inc4.0 (104 reviews)80 Franklin St, Belleville, NJ 07109, USA
Shi's Cakesu2019 Coffeehouse5.0 (62 reviews)85 Franklin St, Belleville, NJ 07109, USA
Anthony's Bakery0.0 (0 reviews)90 Franklin St, Belleville, NJ 07109, USA
Caribbean Essence3.0 (83 reviews)91 Heckel St, Belleville, NJ 07109, USA
Silver Lake Cheesesteak & Tacos4.0 (338 reviews)93 Franklin St, Belleville, NJ 07109, USA
Aaliyah's Bakery3.0 (53 reviews)154 Belmont Ave, Belleville, NJ 07109, USA
Emilyu2019s Creations Chocolate Factory4.0 (44 reviews)112 Franklin St, Belleville, NJ 07109, USA
El Bi Social Club5.0 (4 reviews)Newark, NJ 07107, USA
Dolapos kitchen3.0 (51 reviews)421 Central Ave, Newark, NJ 07107, USA
International Hot Bagels4.0 (116 reviews)306 Washington Ave, Belleville, NJ 07109, USA
Categories
Top Visited Sites
NICO Kitchen + Bar4.0 (372 reviews)
Aux Merveilleux de Fred4.0 (116 reviews)
Gallo Nero Ristorante Italiano4.0 (372 reviews)
Jia Foo3.0 (91 reviews)
Omni Caffe4.0 (124 reviews)
Red Onion Indian Lunch Brunch Dinner4.0 (902 reviews)Top restaurants Searches
Trending Dining Insights Posts
Exploring Dessert Shops That Focus on Interactive and Engaging Customer Experiences
Discovering Sushi Restaurants That Innovate With Traditional and Modern Recipes
How Breakfast Restaurants Are Elevating Everyday Dishes With Unique Ingredients
Best Sushi Restaurants for Every Budget and Taste: A Complete Guide
How Brunch Restaurants Are Experimenting With International Fusion Dishes
Exploring Dessert Restaurants That Combine Art and Flavor
