Dine Droop
Dine DroopDining Insightsrestaurants near me
ConnecticutNew JerseyNew York

Dine Drooprestaurants near meNew JerseyHudson CountyKearnyrestaurants in Kearny AvenueDaily Spot Cafe
Daily Spot Cafe ico

Daily Spot Cafe
- 247 Kearny Ave, Kearny, NJ 07032

Ecuadorian restaurant ★4.0 (34)·$10–20

247 Kearny Ave, Kearny, NJ 07032, USA

4.0
I walked in to this place, after me 2 groups of people walked in. I waited more than 30 minutes for my mote pillo..both groups were served and atiendes before me.. this dish is supposed to come with beef.. after the wait, I brought my food home. I can’t eat pork and was very specific that I wanted beef with it. I paid $17 for this.. Im dissapointed. It’s Just not fear. - Ines Dávila
Daily Spot Cafe Overview Intro Detail Photos Location Reviews
$10–20 per person Reported by 34 people$1–10$10–20$20–30

Daily Spot Cafe Introduce

For New Jersey diners seeking an authentic taste of South America, the Daily Spot Cafe in Kearny offers a unique and welcoming destination. Far from a typical American diner, this establishment is a dedicated Ecuadorian restaurant, bringing the rich, comforting, and flavorful cuisine of Ecuador right to Kearny Avenue. It serves as a true local gem, providing a casual, cozy atmosphere where the community—especially locals and families—can gather for a satisfying meal any time of the day.

The cafe is built on strong community values and proudly identifies as both Black-owned and women-owned, offering a distinct and important presence within the local New Jersey business landscape. It’s a place where authentic, traditional dishes take center stage. While the menu caters to all major meal times, from Breakfast through Dinner, the core appeal lies in the genuine Ecuadorian offerings. Customers consistently rave about staples like the delicious ceviche (often served with fish or shrimp, tomatoes, onions, and lemon juice) and hearty bolones (fried green plantain dumplings, often mixed with cheese or pork cracklings, known as chicharrón). This spot is perfect for those looking for genuine flavors, hearty portions of Comfort food, and a reliable quick meal or leisurely dining experience.

---

## Location and Accessibility

The Daily Spot Cafe is conveniently situated at 247 Kearny Ave, Kearny, NJ 07032, placing it right on a main thoroughfare in the bustling Kearny community. This central location makes it easily reachable for patrons from surrounding New Jersey neighborhoods looking for high-quality, authentic Ecuadorian cuisine. Its street-level presence ensures it is a prominent spot for passing foot traffic and those driving to the area.

Regarding accessibility and parking, the cafe offers several convenient options to accommodate its diverse clientele. Parking is made relatively easy with access to a Free parking lot as well as both Free street parking and Paid street parking options available nearby. The dining environment itself is designed for comfort, offering a Casual and Cozy ambiance. While specific notes on wheelchair accessibility are not provided, the ground-floor presence on a main street generally makes it accessible for most patrons. The focus is on providing a comfortable, welcoming experience for everyone, from Locals grabbing a coffee to Family-friendly groups settling in for a meal.

---

## Services Offered

The Daily Spot Cafe provides a full array of services that cater to modern dining preferences, ensuring you can enjoy their authentic food wherever you prefer—in the cafe or in the comfort of your own home. The flexibility in service options is a major draw for busy New Jersey customers:

  • Flexible Dining: Patrons have the choice of a relaxed Dine-in experience with comfortable Seating and Counter service, or they can opt for convenience with Takeout, Delivery, and Curbside pickup options.
  • Full Meal Coverage: The cafe operates throughout the day, offering meals from the first bite of the morning with Breakfast and Brunch, to Lunch and Dinner, including delightful options for Dessert.
  • Catering Services: For larger gatherings, the cafe provides dedicated Catering services, allowing you to bring the authentic flavors of Ecuadorian comfort food to your next event.
  • Payment Convenience: The cafe accepts modern payment methods, including major Credit cards, Debit cards, and NFC mobile payments, ensuring a quick and hassle-free transaction.
  • Family-Focused Amenities: The cafe is Good for kids, offering both a specific Kids' menu and High chairs to comfortably accommodate families dining in.
  • Coffee Focus: A highlight is the dedicated coffee service, providing fresh Coffee options perfect for starting your morning or enjoying with dessert.

---

## Features / Highlights

What makes the Daily Spot Cafe a standout in the Kearny dining scene is the fusion of high-quality cuisine with its distinct identity and welcoming environment. The following are key features and highlights:

  • Exceptional Coffee: The cafe is specifically highlighted for having Great coffee, a crucial feature for any morning routine or afternoon pick-me-up.
  • Authentic Comfort Food: The menu is centered on delicious Comfort food, featuring traditional Ecuadorian specialties like various types of Bolones and seafood dishes such as Ceviche. It’s the ideal place for a filling and satisfying meal.
  • Dietary Versatility: The menu offers simple, satisfying options like Quick bite items and Small plates, making it adaptable for various appetites and schedules.
  • Diverse Meal Popularity: The cafe is highly Popular for Breakfast, Lunch, and Dinner, confirming its ability to serve delicious food consistently throughout the day. It is also a well-loved choice for Solo dining.
  • Inclusive Ownership: The cafe proudly identifies as both a Black-owned and women-owned business, offering a unique opportunity for the community to support diverse local entrepreneurship.
  • Welcoming Crowd: The atmosphere is consistently described as Casual and Cozy, attracting a crowd of Locals and being highly Family-friendly, fostering a sense of community.

---

## Contact Information

To place an order for pickup, inquire about the menu, or arrange catering for an upcoming event, please contact the Daily Spot Cafe using the following details:

  • Address: 247 Kearny Ave, Kearny, NJ 07032
  • Phone: (862) 403-8853 or +1 862-403-8853

---

## What is Worth Choosing

For New Jersey residents, Daily Spot Cafe represents a vibrant cultural and culinary anchor, offering a much-needed break from the usual dining options. What is truly worth choosing here is the authenticity and quality of the Ecuadorian cuisine coupled with the warm, community-focused service. Customers repeatedly praise specific menu items like the delicious ceviche and bolones, highlighting the reasonable prices and wonderful service they receive, solidifying its reputation as a local "gem."

While an occasional customer may experience a hiccup with order specifications or wait times—which is a reality of any busy, high-quality restaurant, as illustrated by one review regarding a miscommunication about the protein accompanying the mote pillo—the overall consensus and the strong array of positive features outweigh these isolated incidents. The cafe’s dedication to providing genuine, hearty food, even as a small business, is clear. The mote pillo itself is a traditional Ecuadorian dish of hominy corn sautéed with eggs, onions, and spices, typically served with sides that vary by region, and the cafe’s ability to offer this and other regional specialties like various soups and stews is a testament to its authentic roots.

Choosing Daily Spot Cafe means supporting a local, Black-owned, women-owned business that is committed to delivering flavorful Comfort food for Breakfast, Lunch, and Dinner. The combination of a cozy atmosphere, convenient service options (including Curbside pickup and Delivery), and genuine Ecuadorian cooking makes it an essential stop on Kearny Avenue for anyone seeking a unique and satisfying culinary experience in New Jersey.

Daily Spot Cafe Details

  • From the business

  • Identifies as Black-owned
  • Identifies as women-owned
  • Service options

  • Curbside pickup
  • Delivery
  • Takeout
  • Dine-in
  • Highlights

  • Great coffee
  • Popular for

  • Breakfast
  • Lunch
  • Dinner
  • Solo dining
  • Offerings

  • Coffee
  • Comfort food
  • Quick bite
  • Small plates
  • Dining options

  • Breakfast
  • Brunch
  • Lunch
  • Dinner
  • Catering
  • Counter service
  • Dessert
  • Seating
  • Amenities

  • Restroom
  • Atmosphere

  • Casual
  • Cozy
  • Crowd

  • Family-friendly
  • Locals
  • Payments

  • Credit cards
  • Debit cards
  • NFC mobile payments
  • Credit cards
  • Children

  • Good for kids
  • High chairs
  • Kids' menu
  • Parking

  • Free parking lot
  • Free street parking
  • Paid street parking
  • Parking

Daily Spot Cafe Photos

Daily Spot Cafe Picture 1Daily Spot Cafe Picture 2Daily Spot Cafe Picture 3Daily Spot Cafe Picture 4Daily Spot Cafe Picture 5Daily Spot Cafe Picture 6Daily Spot Cafe Picture 7Daily Spot Cafe Picture 8Daily Spot Cafe Picture 9Daily Spot Cafe Picture 10

Daily Spot Cafe Location

Daily Spot Cafe

247 Kearny Ave, Kearny, NJ 07032, USA

Daily Spot Cafe Reviews

An average rating of ★4.7 from 84 user reviews.

encebolladopricehumitasecoempanadasfishsteakcevichegemspeaking

★ 5★ 4★ 3★ 2★ 1

More restaurants near me

  • ConsigliereConsigliere4.0 (60 reviews)

    31 Warren St, Newark, NJ 07102, USA

  • Crown Fried ChickenCrown Fried Chicken4.0 (108 reviews)

    64 Franklin St, Belleville, NJ 07109, USA

  • Masagana Enterprises IncMasagana Enterprises Inc4.0 (104 reviews)

    80 Franklin St, Belleville, NJ 07109, USA

  • Shi's Cakesu2019 CoffeehouseShi's Cakesu2019 Coffeehouse5.0 (62 reviews)

    85 Franklin St, Belleville, NJ 07109, USA

  • Anthony's BakeryAnthony's Bakery0.0 (0 reviews)

    90 Franklin St, Belleville, NJ 07109, USA

  • Caribbean EssenceCaribbean Essence3.0 (83 reviews)

    91 Heckel St, Belleville, NJ 07109, USA

  • Silver Lake Cheesesteak & TacosSilver Lake Cheesesteak & Tacos4.0 (338 reviews)

    93 Franklin St, Belleville, NJ 07109, USA

  • Aaliyah's BakeryAaliyah's Bakery3.0 (53 reviews)

    154 Belmont Ave, Belleville, NJ 07109, USA

  • Emilyu2019s Creations Chocolate FactoryEmilyu2019s Creations Chocolate Factory4.0 (44 reviews)

    112 Franklin St, Belleville, NJ 07109, USA

  • El Bi Social ClubEl Bi Social Club5.0 (4 reviews)

    Newark, NJ 07107, USA

  • Dolapos kitchenDolapos kitchen3.0 (51 reviews)

    421 Central Ave, Newark, NJ 07107, USA

  • International Hot BagelsInternational Hot Bagels4.0 (116 reviews)

    306 Washington Ave, Belleville, NJ 07109, USA

  • Categories

    Top Visited Sites

    Top restaurants Searches

    Trending Dining Insights Posts