Fusion Juice Bar Introduce
In the bustling landscape of New York City, finding a place that combines health, freshness, and great taste can feel like a rare find. For residents and visitors in Astoria, Fusion Juice Bar at 34-02 36th Ave is a shining example of this perfect blend. More than just a simple juice shop, it's a wellness hub that offers a comprehensive menu of healthy and delicious options. From vibrant, freshly squeezed juices and superfood smoothies to hearty breakfast items and wholesome wraps, Fusion Juice Bar has established itself as a go-to spot for those committed to a healthier lifestyle. The atmosphere is casual yet trendy, a perfect setting to relax and recharge. The commitment to using fresh, high-quality ingredients is evident in every item on the menu, ensuring that you're not just getting a tasty meal, but one that is also nourishing and beneficial for your well-being. It’s a place that proves that eating healthy doesn’t have to be boring; it can be an exciting and flavorful experience.
Fusion Juice Bar has garnered a loyal following in Astoria, with customers consistently praising the quality and freshness of their offerings. As one reviewer noted, the place is their "go-to" for healthy, fresh, and delicious options, and a staple in their weekly routine. This isn’t just a spot for a quick drink; it's a full-fledged eatery that provides a variety of meals for any time of day. Whether you’re looking for a substantial breakfast to kick-start your day, a light and healthy lunch, or a satisfying snack, Fusion Juice Bar has you covered. The positive feedback on the staff's kindness and patience, particularly when dealing with families, adds to the welcoming and friendly vibe of the place. It's an establishment that understands its community, offering a clean environment and a menu that caters to a wide range of tastes and dietary needs, from vegan to protein-focused. The fact that customers feel "so good spending my money here" speaks volumes about the value and quality they receive.
Located at 34-02 36th Ave, Astoria, NY 11106, USA, Fusion Juice Bar is a convenient and accessible destination in a lively part of Queens. Its street-side location in Astoria makes it a perfect stop for locals and those passing through the neighborhood. The area is well-connected and easy to navigate on foot, making it a great place to visit for a walk or a bike ride. For those driving, paid street parking is available, offering a practical option. The restaurant is also mindful of accessibility, featuring a wheelchair-accessible entrance, which ensures that all members of the community can enjoy their offerings without any hindrance. The proximity to other local businesses and residential buildings makes it a natural gathering spot for a solo break or a meeting with friends. This prime location is a key factor in its popularity, as it provides a healthy and convenient escape from the urban hustle and bustle.
Fusion Juice Bar offers a variety of services designed to fit the modern New Yorker's lifestyle. Their flexible options make it easy to enjoy their healthy fare on your own terms.
Services Offered:
- Delivery: For those days you can't make it to the shop, Fusion Juice Bar partners with popular delivery services to bring their fresh juices, smoothies, and meals directly to your door.
- Takeout: Ideal for a quick grab-and-go meal, their efficient takeout service ensures you get your order promptly.
- Dine-in: With a casual and trendy atmosphere, the shop provides a pleasant space to sit and enjoy your food and drinks.
The menu at Fusion Juice Bar is a treasure trove of healthy and delicious creations. They offer an incredible array of choices, from energizing smoothies and fresh juices to satisfying wraps and full meals. The Fusion Wraps section includes popular items like the Vegan Wrap and Chicken Cutlet Wrap, while the Quinoa Bowls and Fusion Salads offer nutrient-dense alternatives. Their Fusion Acai Bowls are a particular highlight, with options like the P. B. Fusion Acai Bowl and the Sunset Acai Bowl receiving rave reviews. For a lighter touch, their Fresh Juice lineup features powerful concoctions like the The Hulk Juice and the Daily Detox Juice. Beyond the health-focused items, they also serve up satisfying comfort food like the Beyond Burger and Crispy Chicken Tacos. For breakfast lovers, the menu is extensive, featuring everything from Avocado Toast and High Protein Omelette to Waffles and French Toast. To quench your thirst, they offer a variety of Super Protein Smoothies and Fusion Coffee Blends, ensuring you have the perfect drink to complement your meal. This diverse menu ensures that regardless of your cravings or health goals, you'll find something to love at Fusion Juice Bar.
What truly sets Fusion Juice Bar apart are its key features and the commitment to quality that shines through in every aspect of the business. These highlights make it a standout in a competitive market.
Features and Highlights:
- Healthy Focus: The entire menu is built around providing healthy options, from fresh juices and smoothies to organic meals and salads. It is a fantastic spot for anyone looking for a nutritious and delicious meal.
- Solo Dining Friendly: The casual and relaxed atmosphere makes it a great place for solo diners to grab a quick and healthy meal.
- Kids' Menu: The establishment is considered good for kids and has a kids' menu, making it a great option for families. The "sweet" and "patient" staff, as noted by a customer, adds to this family-friendly environment.
- Trendy and Casual Vibe: The atmosphere is modern and inviting, striking the perfect balance between trendy and comfortable. It's a great place to hang out or grab something on the go.
- Quality Ingredients: Customers consistently praise the freshness of the ingredients, a clear indicator of the shop's commitment to quality. The "Chipotle empanada" was noted for being "not greasy and stuffed," and the juices for being "excellent."
- Convenient Payments: The juice bar accepts all major payment methods, including credit cards, debit cards, and NFC mobile payments, making transactions quick and easy.
While one customer noted that juice making stopped before closing time, this is a common practice for many establishments to ensure a smooth closing process. However, the overwhelmingly positive reviews about the food quality, fast service, and friendly staff highlight the consistent and high standard of the business. From the "amazing açaí bowls" to the "delicious and fresh" juices, the feedback is a testament to the fact that Fusion Juice Bar is a reliable and high-quality spot. The dedication of the staff, who are noted to be "so kind and patient," ensures that every visit is a positive one. This blend of quality food and great service is what makes Fusion Juice Bar a staple for New Yorkers seeking a healthier and happier way to eat. It is a place that truly makes you feel good about what you're consuming.
For more information or to place an order, you can contact Fusion Juice Bar using the details below. Their team is ready to assist you with any questions or orders.
Contact Information:
- Address: 34-02 36th Ave, Astoria, NY 11106, USA
- Phone: (347) 738-4024
So, why is Fusion Juice Bar a place worth choosing for your next meal in New York? The reasons are rooted in its dedication to health, flavor, and community. First and foremost, the menu is a perfect fusion of healthy and delicious. You can indulge in a flavorful smoothie or a rich acai bowl without feeling guilty, or you can opt for a full meal like the Grilled Chicken or Organic Wild Salmón. The versatility of their offerings, from quick bites to full meals, makes it suitable for any occasion, whether you're fueling up before a workout or looking for a satisfying lunch. Furthermore, the consistent quality of their ingredients and preparation is a significant draw. Customers repeatedly praise the freshness of the food and the delicious taste, from the "excellent" empanadas to the "amazing" acai bowls. The family-friendly atmosphere and friendly staff also make it a comfortable and welcoming spot for everyone, including kids. The ability to dine in, take out, or have your order delivered provides ultimate convenience, fitting perfectly into the fast-paced New York lifestyle. In a city where it can be difficult to find truly healthy and fresh food, Fusion Juice Bar stands out as a reliable and trusted oasis. It's a place that not only serves great food but also genuinely contributes to the well-being of its customers, making it a truly valuable asset to the Astoria community.
Fusion Juice Bar Food & drink
Fusion Wraps
- Vegan Wrap $10.49
Vegan. The classic hummus, baby spinach, cucumbers, tomatoes and avocado.
- Caesar Wrap $11.49
Romaine lettuce, croutons, chicken and light caesar dressing.
- Mexican Love Wrap $10.49
Pico de gallo, chicken, lettuce and avocado.
- Tuna Wrap $10.49
Tuna salad, lettuce and tomatoes.
- Avocado Wrap $10.49
Avocado, cucumber, tomatoes, baby spinach and light balsamic vinaigrette.
- Popeye Wrap $10.49
Spinach, organic hard boiled eggs, avocado, and quinoa.
- Chicken Cutlet Wrap $12.99
Chicken cutlet breast breaded, lettuce, tomatoes, mustard, avocado and whole-wheat wrap.
- Fusion Modern Wrap $10.99
Spicy chicken, mango, lettuce and cranberry sauce.
Energy Shots
- Wheatgrass Shot $3.99
- Immune Boost Shot $5.99
Ginger, lemon, turmeric and cayenne.
- Super Boost Shot $5.49
Ginger, lemon and cayenne.
Smoothies
- Protein Knock-Out Smoothie $10.49
Strawberries, bananas, peanuts butter, low fat milk and whey protein.
- Super Antioxidant Smoothie $8.49
Blueberries, bananas, acai juice and pomegranate juice.
- Pina Colada Smoothie $8.49
Pineapple, coconut syrup, banana and pineapple juice.
- My Faves Smoothie $8.49
Strawberries, blueberries, raspberries, pomegranate juice and acai juice.
- Cool Mango $8.49
Pineapple, mango, banana and mango juice.
- Green Machine Smoothie $8.49
Pineapple, banana, spirulina, low fat yogurt and pineapple juice.
- Sweet Dragon $8.99
Pineapple, banana, peach, pitaya, orange juice.
- Peanut Butter Yum Smoothie $8.49
Bananas, peanuts butter, low fat yogurt and low fat milk.
- Strawberry Banana Smoothie $7.99
Banana, strawberries, almond milk.
- Berry Dreams Smoothie $8.49
Blueberries, strawberries, raspberries and acai juice.
Granola Parfait
- Granola Parfait $5.99
Low-fat yogurt, bananas, berries, granola and raw organic honey.
Raw Remedies
- Diabetes $10.64
Carrots, celery, spinach and green apple.
- Hypertension $10.64
Spinach, pineapple and carrots.
- Headache $10.64
Beets, carrots, ginger and cucumber.
- Hangover Killer $10.64
Carrots, lemon, ginger, beets and green apple.
- Low Blood Pressure $10.64
Pear, celery, orange and green apples.
- Anemia $10.64
Spinach, carrots and beets.
- Asthma $10.64
Celery, carrots, orange and grapefruit.
Quesadillas
- Crispy Chicken Tacos (3) $9.99
Grill chicken, guacamole and pico de gallo.
- Chicken Quesadillas $13.49
Black beans, brown rice, monster cheese, cheddar cheese, guacamole, chicken.
- Shrimp Spicy Quesadilla $14.99
Brown rice, jalapeño, tomato, red onion, red bell pepper, corn, shrimp and mix cheese.
Soups
- Chicken Noodle $6.99
Served in an 8 oz cup.
- Lentil Soup $6.99
Served on an 8oz cup.
- Carrot Ginger $6.99
Served in an 8oz cup.
- Split Pea $6.99
Fusion Coffee Blend
- Simple Coffee $7.99
Organic all real coffee, organic milk, frozen greek vanilla yogurt, .
- Almond Coffee $7.99
Almond butter, organic all real coffee, frozen greek vanilla yogurt, almond milk.
- Acai Coco $8.49
Acai, coconut water, organic all real coffee, frozen greek vanilla yogurt.
Breakfast
- Western Omelette $12.99
Turkey, ham, red onions, sweet peppers.
- Vegetarian Wrap $8.99
2 organic egg whites, kale, spinach, and sweet peppers.
- Almond Butter Toast $7.49
Almond butter, green apple, and whole wheat bread.
- Mexican Omelette $12.49
Red onions, tomatoes, jalapeno, guacamole.
- Bacon, Egg And Cheese $6.99
Koshers roll, bacon, egg and cheese.
- Waffles $9.99
Order of one belgian waffle with seasonal fruit.
- Grilled Chicken And Avocado Wrap $9.49
Grilled chicken, 2 organic eggs, and avocado.
- Turkey, Egg, And Cheese Wrap $8.49
2 organic eggs, turkey, and cheese.
- High Protein Omelette $12.49
Egg whites, spinach, feta cheese.
- Hot Oatmeal $6.49
Oatmeal, bananas, berries, and raw honey.
- French Toast $9.99
Whole week french toast. Seasonal fruits.
- Greek Omelette $12.99
Black olives, feta cheese, red onions, sweet peppers, tomatoes.
- Three Cheese Omelette $12.49
Fresh mozzarella, mixed cheese.
- Avocado Toast $9.99
Avocado, tomato, cucumber, and whole wheat bread.
- Healthy Omelette $12.99
Egg whites, kale, avocado, quinoa, tomatoes.
- Huevos Rancheros $11.25
2 eggs, sunny side with black beans, brown rice, pico de gallo and guacamole.
- Avocado Toast Supreme $11.99
Avocado mashed ,smoke salmon , red pepper, and whole wheat toast
- Scrambled Kale And Quinoa $11.99
Mixed kale with quinoa over scrambled eggs with avocado, tomatoes and chipotle mayonnaise.
- Peanut Butter Toast $6.99
Peanut butter, banana, and whole wheat bread.
- Omelette Combo $14.99
Any omelette with small orange juice.
- Good Morning Bowl $8.99
Low fat yogurt, granola, seasonal foods, and honey.
Desserts
- Red Velvet Cake $4.99
- Carrot Cake $5.99
Fusion Acai Bowls
- P. B. Fusion Acai Bowl $14.99
Acai berry, banana, peanuts, sliced almonds, coconut shaves, peanut butter, hemp granola.
- Açaí Nutella $13.99
Açaí berry, strawberry, banana, hemp granola and nutella.
- Acai Verde Bowl $14.99
Acai berry, banana, kale, spirulina, seasonal fruit, hemp granola.
- Almond Butter Bowl $15.49
Acai, almond milk, almond butter, coconut flakes, hemp granola.
- Create Your Açaí Bowl $10.99
Açaí mixed with banana as the base.
- Sunset Acai Bowl $13.99
Acai berry, banana, seasonal fruit and granola.
- Coco Loco Acai Bowl $14.99
Acai berry, coconut water, banana, seasonal fruits and hemp granola.
- VIP $16.49
Acai berry ,orange juice , banana,mango , pineapple, chia seed , bee pollen , gogi berries, and hemp granola.
- Almond Protein $15.99
Acai berry, almond milk, almonds butter, coconut flakes, seasonal fruits, vegan protein, hemp granola.
Quinoa Bowls
- Fusion Quinoa $9.50
Blueberries, strawberrys, green apple, orange, pineapple, mango, almond and apple cider vinaigrette.
- Quinoa Taco Salad $13.49
Corn, cherry tomatoes, cucumber, red onion, cilantro, guacamole, tortilla strips and chicken.
- Mediterranean Quinoa $12.49
Red bell pepper, cherry tomato, garbanzo beans, red onions, calamari black olives, feta cheese, parsley, romaine lettuce, lemon and olive oil dressing.
- Grilled Salmon Tex Mex $16.99
Quinoa, pico de gallo, avocado, grilled salmon, corn and chipotle mayo sauce.
Sodas
- Coke (Can) $1.99
The cold, refreshing, sparkling classic that America loves.
- Diet Coke (Can) $1.99
A crisp, refreshing taste you know and love with zero calories.
- Fanta (Can) $1.99
Change up your routine with the bright, bubbly, fruity orange flavor.
- Canada Dry Seltzer Water (Can) $1.99
- Red Bull (Small) $3.49
- Canada Dry Ginger Ale (Can) $1.99
Sides
- Complete Cookies $3.99
Chocolate chips.
- Sweet Potato Fries $6.49
- French Fries $6.49
- Fried Onion Rings $6.49
Fusion Extreme Coconut Blends
- Fusion Extreme Coconut Blend $10.99
Coconut water, fresh coconut, dragon fruit, mango, Goji berries, dates, chia seeds, maca and raw cacao.
- Rainforest Coconut Blend $10.49
Coconut water, fresh coconut, papaya, mango, pineapple, strawberries and banana.
- Kalefornia Coconut Blend $10.49
Coconut water, fresh coconut, kale, spinach and banana.
- Crazy Coco Coconut Blend $10.49
Coconut water, fresh coconut, acai, banana, blueberries and coconut flakes.
Super Protein Smoothies
- Pre-Workout $11.99
Cold brew coffee, almond milk ,banana ,peanut butter , maca powder, whey protein.
- Sexy Peach Smoothie $10.49
Strawberry, peach, banana, fresh orange juice and whey protein isolate.
- Fat Burner Smoothie $10.99
Pineapple, blueberries, banana, acai juice and lean one protein.
- Zero Carbs Smoothie $9.75
Spinach, kale, chia seeds, almond milk and zero carbs isopure.
- Berry Berry Protein Smoothie $9.99
Strawberries, blueberries, raspberries and acai whey protein.
- Fiber And Protein $11.99
Banana, peanut butter, oats , kale , chia seeds, 2 scoops of whey protein and oat milk
- Weight Gainer Smoothie $11.99
Peanut butter, banana, low fat yogurt, low fat milk, coconut oil and two scoops whey protein.
- Super Vegan Smoothie $9.49
Vegan. Spinach, kale, spirulina, quinoa milk and vegan one protein.
Meals
- Organic Wild Salmón $14.99
- Jumbo Shrimp $14.99
- Grilled Chicken $13.99
Bagels
- Egg On The Bagel $7.49
Plain toasted bagel, organic eggs, american cheese, bacon, avocado. .
- Regular Plain Bagel $4.49
Regular plain bagel toasted, cream cheese, jelly.
- Whole Wheat Tuna Bagel $7.49
Whole-wheat toasted bagel, tuna salad, lettuce, tomato. .
Fusion Tossed Salad
- Fusion Tossed Salad $9.99
Your choice of greens, toppings and dressing.
Fusion Salad
- Kale Salad $12.99
Avocado, tomatoes, walnuts, cherry tomatoes, cranberries, croutons and light caesar dressing.
- Detox Salad $14.99
Red apple, carrots ,red bell peppers, avocado ,baby arugula,sesame seeds ,in olive lemon apple cider vinaigrette
- Buddha Bowl $13.49
Kale, quinoa, cranberries, green apples, celery, cucumber, orange, almonds, carrots and chickpeas in olive oil and orange lemon dressing.
- Mexican Chopped Salad $13.49
Corn, avocado, tomatoes, red onion, red bell peppers, cucumber, feta cheese, romaine lettuce and cilantro lime dressing.
- Shrimp & Avocado Salad $15.99
Spring mix, mango, avocado, dried cranberries, tomatoes, carrots, and delicious spicy shrimp topped with coconut dressing.
- Protein Salad $13.99
Beans, avocado, chicken, tomatoes, turkey, baby spinach and olive oil lemon.
Superfood Smoothies
- Superhero Smoothie $9.75
Goji berries, cacao powder, chia seeds, strawberries, dates and almond milk.
- Bee Pollen Smoothie $9.49
Blueberry, banana, dates, bee pollen and soy milk.
- Skinny Minnie Smoothie $9.49
Almond milk, banana, chia seeds, kale, spinach, spirulina and moringa.
- Bananarama Smoothie $9.49
Soy milk, banana, mango, strawberries, yogurt, coconut oil, chia seeds and bee pollen.
- The Pink Panther Smoothie $9.49
Raspberries, bananas, maca, pineapple and camu camu.
- Chocolate Dream Smoothie $9.49
Almond milk, yogurt, banana, almonds, raw cacao, maca and lucuma.
From The Grill
- Beyond Burger $15.99
25grs protein beyond burger, guacamole, spicy pickle jalapeños, tomato and lettuce.
- Chipotle Turkey Burger $15.99
Turkey burger, lettuce, tomato, onion, chipotle mayo served with french fries.
- Vegan Nachos $10.99
Vegan. Nachos, pico de gallo, guacamole.
- Bison Burger $17.99
Bison burger, swiss cheese, tomato, caramelized onions, lettuce, and tomato, mayonnaise ketchup sauce. .
- Vegan Burger $15.95
Vegan. Lentil and quinoa burger, pico de gallo served with sweet potato fries.
- Portobello Burger $13.99
Portabella mushroom, tomato, lettuce and onion. Served with sweet potato fries.
- Chipotle Salmon Burger $15.99
Salmon burger, lettuce, tomato, chipotle mayonnaise, sweet potato fries. .
Hot Drinks
- Organic Tea $3.74
Green tea chamomile yerba mate black tea.
- Expresso $4.99
- Lemon Ginger Drop $3.74
- Cappuccino (Large) $4.75
- Skinny Girl $4.99
- Latte $5.49
- Cappuccino (Small) $3.99
- Maya Chocolate $4.49
- Organic Hot Coffee $3.24
Hot organic black coffee.
- Organic Iced Coffee $4.49
- Nitro Organic Cold Brew Coffee $5.25
Organic nitro cold brew coffee.
Avocado Toast
- Avocado Toast And Bacon $10.49
Avocado toast, bacon, .
- Avocado Toast And Tuna Salad $10.49
Avocado, tuna salad, toast.
- Avocado Toast Supreme $11.49
Avocado toast, smoke salmon, red pepper flakes. .
- Avocado Toast And Boiled Eggs $10.49
Avocado toast and boiled organic eggs.
- Avocado Toast And Turkey $9.49
Avocado toast and roasted turkey breast.
Fresh Juice
- Fresh Squeezed Orange Juice $10.00
- Tropical Juice $10.64
Orange, green apple and pineapple.
- O Veggies Juice $10.64
Kale, beets, carrots, spinach, cucumber and celery.
- The Hulk Juice $10.64
Celery, kale, spinach, green apples and cucumber.
- Vitamin C Juice $10.64
Orange, pineapple, lemon and grapefruit.
- Fat-Reducer Juice $10.64
Cucumber, ginger, lemon and pineapple.
- Daily Detox Juice $10.64
Spinach, carrots, cucumber, lemon and ginger.
Water
- Fiji Water $4.49
- Harmless Coconut Water $6.49
- Essentia Water $5.49
1.5 liter.
- Smart Water $4.49
Every drop tastes pure and will leave you feeling refreshed.
- Poland Spring (Small) $2.49
Sandwich Fusion
- Chicago Grill Sandwich $12.49
Grilled chicken, pico de gallo, avocado and tomatoes.
- Blt Sandwich $11.99
Bacon, lettuce, tomato, mayonnaise and hero bread. .
- Chicken & Pesto Sandwich $12.99
Grilled chicken, fresh mozzarella, lettuce, avocado and pesto sauce.
- Chipotle Mayo Sandwich $12.99
Grilled chicken, avocado, lettuce and chipotle mayo on panini.
- Cheese Lovers $11.99
Fresh mozzarella, pesto sauce, arugula, fresh tomatoes , and panini bread
- Chicken Sandwich $14.99
Lettuce, tomatoes,avocado ,chicken breast breaded, mustard,mayonnaise and brioche bun with French fries
- Tuna Sandwich $11.99
Tuna salad, lettuce, tomatoes, avocado and whole wheat bread.
Fusion Juice Bar Details
Service options
- Delivery
- Takeout
- Dine-in
Popular for
- Solo dining
Accessibility
- Wheelchair accessible entrance
- Wheelchair accessible parking lot
Dining options
- Dessert
- Table service
Amenities
- Restroom
Atmosphere
- Casual
- Trendy
Payments
- Credit cards
- Debit cards
- NFC mobile payments
Children
- Good for kids
- Kids' menu
Parking
- Paid street parking
Fusion Juice Bar Photos










Fusion Juice Bar Location
Fusion Juice Bar Reviews
smoothieacai bowlshealthypricechickendeliverywrapsqualityempanadacup
★ 5★ 4★ 3★ 2★ 1Healthy stuff. They stopped making juices at 520 because she said they were about to close.Chipotle empanada with chipotle sauce was excellent. Not greasy and stuffed.
February 15 · MichaelThis place is our one for protein shake every Friday, after the swimming class of our kids. The girl is so kind and patient. They have healthy option for eat and the place always clean.
May 25 · Karla TorresI’ve been enjoying this açaí for 3 years, and nothing compares! It’s my absolute favorite, whether I’m dining in or getting it delivered. I just can’t resist it!
October 24 · Dayana JimenezHad a chicken sandwich and loved it: the bread was fresh and fluffy and it was nicely presented. The staff was very friendly with me. I want to go back and try their Acai bowls.
June 30 · Guilherme LouzadaI would drive past this juice bar often and finally deceided to stop and get 2 juices. I am not sure but a gentleman who may have been the owner made my 2 juices and a young lady took my order and neither was very friendly or personable. I must say the juices were good though and I even got a chicken empanada which was also good. Unfortunately, I work in the hospitality industry and I am big on customer service so I will not be returning because of the attitude of the servers and/or owner. I wanted to ask questions about the juices but I was not comfortable doing so. Please work on that because I would have been a loyal customer.
March 02 · Robyn Barnett
More restaurants near me
Ecuadorian Food II4.0 (283 reviews)34-06 36th Ave, Long Island City, NY 11106, USA
Taco Veloz Astoria4.0 (72 reviews)34-01 36th Ave, Astoria, NY 11106, USA
Elio's4.0 (153 reviews)33-17 36th Ave, Astoria, NY 11106, USA
Taco Deli Spot4.0 (99 reviews)34-11 36th Ave, Astoria, NY 11106, USA
Dive Bar LIC4.0 (419 reviews)33-10 36th Ave, Long Island City, NY 11106, USA
Arepas Cafe4.0 (1805 reviews)33-07 36th Ave, Astoria, NY 11106, USA
Rio Bonito Grill4.0 (1216 reviews)33-01 36th Ave, Astoria, NY 11106, USA
Psari4.0 (876 reviews)32-10 36th Ave, Long Island City, NY 11106, USA
Escola's Corp. Restaurant4.0 (4 reviews)32-04 36th Ave, Long Island City, NY 11106, USA
Maison Mekong4.0 (191 reviews)36-02 36th Ave, Astoria, NY 11106, USA
Dunkin'3.0 (91 reviews)35-30 36th St Ste A, Long Island City, NY 11106, USA
Pig Beach BBQ Queens4.0 (945 reviews)35-37 36th St Ground Floor, Astoria, NY 11106, USA
Categories
Top Visited Sites
I Got The Juice4.0 (96 reviews)
1484 Avenue Bakery Corporation4.0 (56 reviews)
ACQ Bread4.0 (111 reviews)
Cupido's Bar & Restaurant4.0 (136 reviews)
El Chapin Restaurant & Grill4.0 (12 reviews)
Salad Ace0.0 (0 reviews)Top restaurants Searches
Trending Dining Insights Posts
How Brunch Restaurants Are Experimenting With International Fusion Dishes
Best Sushi Tasting Menus Curated by Expert Chefs for an Unforgettable Dining Experience
How Fast Food Restaurants Are Incorporating Local Ingredients Into Signature Items
How Wine Bars Are Pairing Unique Wines With Local Dishes
How Mediterranean Restaurants Are Balancing Flavor and Health
How Vegan and Vegetarian Restaurants Are Expanding in Urban Areas: A Growing Trend
