Dine Droop
Dine DroopDining Insightsrestaurants near me
ConnecticutNew JerseyNew York

Dine Drooprestaurants near meNew YorkBronx CountyMorris Parkrestaurants in Morris Park AvenueHealthy Fresh
Healthy Fresh ico

Healthy Fresh
- 1033 Morris Park Ave, Bronx, NY 10461

Health food restaurant, Juice shop ★4.0 (52)·$10–20

1033 Morris Park Ave, Bronx, NY 10461, USA

4.0
Ordered here for the first time because I was craving a chicken caesar salad wrap. But I was VERY disappointed not only in the flavors of the food, but in the quantity for the price.This wrap was $13+ because I added French fries (which were $1.50). You can eat the wrap in 3 bites! The chicken was super dry and lacked flavor, the wrap barely had any dressing and tasted burnt. Absolutely terrible experience.. In the picture you will see half the wrap, and it’s smaller than the ginger ale. Barely had any filling. Do not order from here unless you want really small portions of mediocre food.Plenty of deli’s in the area that make better food, bigger portions & great pricing. This is what I get for being lazy and not heading to a worthy location.The healthy fresh owners should be ashamed of the mediocrity. - Vianny Gutierrez
Healthy Fresh Overview Intro Food & drink Detail Photos Location Reviews
$10–20 per person Reported by 52 people$1–10$10–20$20–30

Healthy Fresh Introduce

Welcome to the ultimate guide to **Healthy Fresh**, a prominent name in the **Bronx, New York**, for fresh, nutritious, and convenient dining. In a bustling metropolis like NYC, finding quick, healthy food that doesn't compromise on flavor or quality can be a challenge. Healthy Fresh steps in as a reliable local solution, operating as a **Health food restaurant**, **Juice shop**, and **Delivery Restaurant** rolled into one. Whether you're a busy professional, a dedicated student, or a health-conscious resident, Healthy Fresh aims to make wholesome eating accessible. This overview will detail everything you need to know about this local gem, from its menu offerings to its accessibility and why it’s worth adding to your dining rotation.

Healthy Fresh isn't just a place to grab a bite; it's a destination for those prioritizing a vibrant and balanced diet. They’ve tailored their concept to cater to the diverse, fast-paced needs of the New York community, offering a broad spectrum of **healthy options**, **vegan options**, and **vegetarian options** that go beyond the typical deli fare. Known for being **popular for** Breakfast, Lunch, and Dinner, they serve customers looking for a **quick bite** or a satisfying, complete meal. For local users in the Bronx and surrounding NYC areas, this establishment represents a great way to maintain a healthy lifestyle without sacrificing convenience.


## Location and Accessibility for New Yorkers

Healthy Fresh is strategically located in the heart of the Bronx, making it a truly local establishment for many residents and commuters. You can find their physical location at **1033 Morris Park Ave, Bronx, NY 10461, USA**. This specific address places them in a high-traffic area, ensuring they are a convenient stop for neighborhood residents and those traveling through the Morris Park area.

For those planning a visit, the establishment focuses on accessibility. It offers a **Wheelchair accessible entrance**, ensuring it can accommodate all members of the community. If you plan on driving, be aware that there is **Paid street parking** available nearby, which is typical for this area of NYC. The overall atmosphere is described as **Casual**, **Cozy**, **Quiet**, and sometimes **Trendy**, creating a welcoming environment for everyone, including **College students** and families, as the location is also deemed **Good for kids**. However, for those who prefer the utmost convenience—a must-have for any busy New Yorker—their designation as a **Delivery Restaurant** is paramount. You can order directly to your home or office, making healthy eating effortless no matter where you are in their delivery zone. They also offer **Takeout** and a comfortable **Dine-in** option.


## Services Offered at Healthy Fresh

Healthy Fresh provides a comprehensive range of dining and service options designed to fit the NYC lifestyle, serving customers from morning until evening.

  • **Delivery:** The core service, providing a convenient way for residents to get fresh, healthy meals delivered right to their door.
  • **Takeout:** Perfect for grabbing a meal, juice, or smoothie on the go for those who are in the area.
  • **Dine-in:** Offers a comfortable and casual spot for patrons to sit, relax, and enjoy their food and drinks.
  • **Extensive Breakfast Menu:** Catering to the early risers with options like Pancakes, various Egg Sandwiches, and an array of flavorful Hot Oatmeals.
  • **Juice Shop Specialization:** Focused on fresh-pressed juices and energizing smoothies, including specific categories like "Go Green To Be Clean" and "Build Your Immune System."
  • **All-Day Healthy Menu:** Serving up fresh Salads (like Chicken Greek and Caesar), flavorful Wraps (including Vegan options), Paninis, and even Burgers/Heroes.
  • **Multiple Payment Options:** Accepting **Credit cards**, **Debit cards**, and **NFC mobile payments** for a seamless transaction.
  • **Dining Options:** Available for **Breakfast**, **Brunch**, **Lunch**, **Dinner**, and **Dessert**.

## Features and Highlights of the Menu

The menu at Healthy Fresh is built around variety, nutritional content, and catering to specific dietary preferences, ensuring everyone in the New York community can find something they love.

  • **Great Tea Selection:** Highlighted as a key feature, perfect for tea aficionados looking for a warm or iced beverage.
  • **Rich Array of Smoothies & Juices:** The menu is incredibly varied, featuring over 20 unique blends across categories like **Energy Smoothies**, **Protein Smoothies** (e.g., E1- Banana, Peanut Butter & Chocolate Protein), and specialized juices designed to **Build Your Immune System** (e.g., C4- Beet, Carrot, Apple, Celery & Ginger).
  • **Customization:** Customers can **Create Smoothie/ Juice** or **Create Salad**, offering flexibility and control over ingredients. The Salad base starts at a reasonable price, allowing for personalization.
  • **High-Protein and Vegan/Vegetarian Focus:** The **Offerings** include **Healthy options**, **Vegan options**, and **Vegetarian options** throughout the menu, from **Vegan Wraps** (Kaiser Wrap, Summer Time Wrap) to protein-packed wraps and paninis.
  • **All-Day Wraps and Paninis:** A strong selection of items like the California Wrap, Italian Wrap, Pesto Panini, and Fajita Panini provides substantial options for lunch and dinner.
  • **Quick Bites and Sides:** Alongside full meals, they offer **Small plates**, **Quick bite** items, and affordable sides like **Chicken Empanada** and **French Fries**.

## Contact Information

To connect with Healthy Fresh for orders, inquiries, or more information, here is the essential contact data for local users in the New York region:

  • **Address:** 1033 Morris Park Ave, Bronx, NY 10461, USA
  • **Phone (Landline):** (718) 684-6411
  • **Phone (Mobile/Direct):** +1 718-684-6411

## What is Worth Choosing at Healthy Fresh

For anyone in the Bronx or surrounding areas seeking a genuinely healthy and fresh meal option, Healthy Fresh presents a compelling choice. The core value here is in the name: the commitment to using **fresh fruits and vegetables** for their expansive juice and smoothie menu. A customer review highlights this, noting, "The name of the place is true. **Healthy and fresh**. The fruits and vegetables are fresh, the place is spotless." This dedication to quality is a significant draw, particularly in the NYC food landscape.

The variety on the menu ensures that you can find a healthy option no matter your craving. Their specialization as a **Juice shop** is a standout feature; with categories like **Healthy Fresh Combinations** (A1- Mega Mix, A8- Piña Colada) and targeted immune-boosting blends, they are a top contender for the best source of cold-pressed goodness in the area. The **Protein Smoothies** section alone—featuring 10 different options—is perfect for fitness enthusiasts or those needing a substantial, on-the-go meal replacement.

While one customer review noted an issue with the portion size and flavor of a specific item (Chicken Caesar Salad Wrap), another review provides a strong counterbalance, praising the service, knowledge of the staff, and the overall quality of the diverse items they ordered, stating, "Everything I order I’m so happy with. I’ve gotten **Salads, Smoothies, Juices** and I’m always pleased." This suggests that the real value lies in their signature healthy options, particularly the vast array of juices and smoothies, which are consistently praised for being both **fresh** and high **quality** for a reasonable price. Given the convenience of **Delivery** and the commitment to **Healthy options**, **Vegan options**, and **Vegetarian options**, Healthy Fresh offers a valuable service to New Yorkers looking to eat well without the fuss. It's an excellent local resource for a quick, nutritious, and convenient healthy fix.

Healthy Fresh Food & drink

  • BREAKFAST - Breakfast

  • Coffee
  • BREAKFAST COMBO $5.50
  • Yogurt Muffins $2.95
  • Tea
  • Pancakes
  • Iced Coffee
  • English Muffin Sandwich $4.50
  • Bagel With Cream Cheese (Plain Bagel Only) $3.50
  • Create Egg Sandwich
  • BREAKFAST - Breakfast Wraps

  • #1 Egg Whites, Turkey Sausage & Avocado $7.99
  • #2 Egg Whites, Turkey Bacon & Avocado $7.99
  • #3 Egg Whites, Bacon, Swiis & Avocado $7.99
  • #4 Egg Whites, Spinach, Broccoli & Avocado $7.99
  • #5 Egg Whites, Turkey Bacon, Cheddar Cheese & Salsa $7.99
  • #6 Egg Whites, Grilled Chicken, Monterrey Jack Cheese & Chipotle Mayo $7.99
  • BREAKFAST - Hot Oatmeals

  • #1 Strawberry, Banana, Granola & Cinnamon $5.49
  • #2 Walnuts, Pecans, Almonds & Agave $5.49
  • #3 Peanut Butter, Apples & Agave $5.49
  • #4 Dried Cranberries, Raisins, Apples & Agave $5.49
  • #5 Strawberry, Banana, Blueberry & Cinnamon $5.49
  • #6 Banana, Chia Seeds & Agave $5.49
  • Breakfast

  • Coffee
  • BREAKFAST COMBO $5.50
  • Yogurt Muffins $2.95
  • Tea
  • Pancakes
  • Iced Coffee
  • English Muffin Sandwich $4.50
  • Bagel With Cream Cheese (Plain Bagel Only) $3.50
  • Create Egg Sandwich
  • Breakfast Wraps

  • #1 Egg Whites, Turkey Sausage & Avocado $7.99
  • #2 Egg Whites, Turkey Bacon & Avocado $7.99
  • #3 Egg Whites, Bacon, Swiis & Avocado $7.99
  • #4 Egg Whites, Spinach, Broccoli & Avocado $7.99
  • #5 Egg Whites, Turkey Bacon, Cheddar Cheese & Salsa $7.99
  • #6 Egg Whites, Grilled Chicken, Monterrey Jack Cheese & Chipotle Mayo $7.99
  • Hot Oatmeals

  • #1 Strawberry, Banana, Granola & Cinnamon $5.49
  • #2 Walnuts, Pecans, Almonds & Agave $5.49
  • #3 Peanut Butter, Apples & Agave $5.49
  • #4 Dried Cranberries, Raisins, Apples & Agave $5.49
  • #5 Strawberry, Banana, Blueberry & Cinnamon $5.49
  • #6 Banana, Chia Seeds & Agave $5.49
  • ALL DAY - Healthy Fresh Combinations

  • A1- Mega Mix

    Strawberry, Pineapple & Papaya with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A2- Berry Happy

    Strawberry, Blueberry & Blackberry with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A3- Tropical Mix

    Mango, Banana & Pineapple with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A4- Mango Tropical

    Mango, Peach, Pineapple & Orange Juice

  • A5- The Secret

    Strawberry, Blueberry & Mango with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A6- Baby Bottle

    Strawberry, Banana & Blueberry with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A7- Mango Tango

    Mango & Orange Juice

  • A8- Piña Colada

    Pineapple & Coco Lopez

  • ALL DAY - Energy Smoothies To Start Your Day

  • B1- Incredible- Banana, Pineapple, Spinach, Apple & Cucumber
  • B2- Mango, Strawberry, Raisins, Oatmeal, Agave & Almond Milk
  • B3- Banana, Mango, Agave & Almond Milk
  • B4- Strawberry, Pineapple, Mango, Agave & Almond Milk
  • B5- Strawberry, Blueberry, Blackberry, Agave & Almond Milk
  • B6- Papaya, Apple, Spinach, Agave & Orange Juice
  • Morning Blast- Plum, Mango, Banana, Spinach, Ginger & Orange Juice
  • Best DATE Ever! - Banana, Dates, Pecans, Almond Milk & Cinnamon
  • ALL DAY - Build Your Immune System

  • C1- Beet, Carrot & Orange
  • C2- Pineapple, Apple & Ginger
  • C3- Grapefruit, Orange, Pineapple & Ginger
  • C4- Beet, Carrot, Apple, Celery & Ginger
  • C5- Spinach, Beet, Carrot & Apple
  • Energizer- C6. Apple, Grapes, Cantaloupe, Watermelon, Ginger & Lemon
  • ALL DAY - Go Green To Be Clean

  • D1- Aloe Vera, Pineapple, Apple & Cucumber
  • Green Juice -D2- Spinach, Kale, Apple, Cucumber, Celery & Pineapple
  • D3- Green Apple, Kale, Pineapple, Cucumber & Lemon
  • D4- Aloe Vera, Pineapple, Apple, Cucumber, Orange & Lime
  • D5- Cucumber, Celery, Apple & Lime
  • D6- Cucumber, Apple, Pineapple & Lime
  • ALL DAY - Protein Smoothies

  • E1- Banana, Peanut Butter & Chocolate Protein

    Made with Almond Milk (No sugar Added)

  • E2- Pineapple, Banana, Spinach, Oatmeal & Protein

    Made with Almond Milk (No sugar Added)

  • E3- Strawberry, Blueberry, Almonds, Oatmeal & Protein

    Made with Almond Milk (No sugar Added)

  • E4- Banana, Blueberry, Peanut Butter & Protein

    Made with Almond Milk (No sugar Added)

  • E5- Papaya, Banana, Pecans, Almonds & Protein

    Made with Almond Milk (No sugar Added)

  • E6- Banana, Cantaloupe, Pecans, Walnuts & Protein

    Made with Almond Milk (No sugar Added)

  • E7- Blueberry, Banana, Oatmeal, Pecans & Protein

    Made with Almond Milk (No sugar Added)

  • E8- Mango, Banana, Peach, Peanut Butter & Protein

    Made with Almond Milk (No sugar Added)

  • E9- Mango, Apples, Kale, Peanut Butter & Protein

    Made with Almond Milk (No sugar Added)

  • E10- Beets, Blueberry, Kale, Peanut Butter & Protein

    Made with Almond Milk (No sugar Added)

  • ALL DAY - Refreshers

  • Energizer- C6. Apple, Grapes, Cantaloupe, Watermelon, Ginger & Lemon
  • Orange Juice
  • Lemonade
  • Slushy Lemonade
  • Watermelon Lemonade

    Watermelon with Lime and a hint of Agave.

  • Picante Watermelon

    Watermelon, Tajin Powder & Agave *lightly spicy*

  • Cucumber Refresher

    Cucumber, Lime & Agave.

  • ALL DAY - Create Smoothie/ Juice🍋🍓

  • 🍌Create Smoothie 🍓
  • Create Juice 🍏
  • ALL DAY - Salads

  • Chicken Greek Salad $12.95

    Romaine Lettuce, Grilled Chicken, Black Olives, Tomatoes, Cucumbers, Red Onions, Peppers & Feta Cheese with Oil and Vinegar

  • Chicken Caesar Salad $8.95

    Romaine Lettuce, Grilled Chicken, Parmesan Cheese, Croutons & Ceasar Dressing

  • Create Salad $3.50
  • Fruit Salad
  • ALL DAY - Wraps

  • California Wrap

    Grilled Chicken, Fresh Mozzarella, Avocado, Lettuce, Tomato & Ranch Dressing

  • Arizona Wrap

    Chicken Cutlet, Monterrey Cheese, Jalapeños Peppers, Lettuce, Tomato & Mayo

  • Monterrey Wrap

    Chicken Cutlet, Monterrey Cheese, Turkey Bacon, Lettuce & Chipotle Sauce

  • Caesar Wrap

    Grilled Chicken, Parmesan Cheese, Crispy Lettuce, Croutons & Caesar Dressing

  • Roma Wrap

    Grilled Chicken, Fresh Mozzarella, Sun-Dried Tomatoes, Fresh Spinach & Pesto Sauce

  • Italian Wrap

    Grilled Chicken, Cucumbers, Crispy Lettuce & Italian Dressing

  • ALL DAY - Paninis

  • Pesto Panini

    Grilled Chicken, Fresh Mozzarella, Roasted Peppers & Pesto Sauce

  • Parmesan Panini

    Chicken Cutlet, Fresh Mozzarella, Parmesan Cheese & Marinara Sauce

  • Fajita Panini

    Grilled Chicken, Cheddar Cheese, Onions, Peppers, Cilantro & Salsa

  • Tuna Melt

    Tuna Salad, Mayo, Cheddar Cheese, Lettuce & Tomato

  • Tuscan Panini

    Fresh Mozzarella, Sun-Dried Tomatoes, Fresh Spinach & Pesto Sauce

  • Chicken Club

    Grilled Chicken, Bacon, Lettuce, Tomato & Mayo

  • Teriyaki Panini

    Grilled Chicken, Zucchini, Squash, Carrots, Mozzarella Cheese & Teriyaki Sauce

  • ALL DAY - Quesadillas

  • Chicken Quesadilla

    Grilled Chicken & Mozzarella

  • Fajita Quesadilla

    Grilled Chicken, Cheddar Cheese, Onions, Peppers, Cilantro & Salsa

  • Vegetable Quesadilla

    Fresh Mozzarella, Grilled Zucchini, Squash & Carrots

  • ALL DAY - Vegan Wraps

  • Kaiser Wrap

    Grilled Zucchini, Grilled Squash, Broccoli Rabe, Avocado & Chipotle Sauce on a Whole Wheat Wrap

  • Summer Time Wrap

    Veggie Patty, Cucumbers, Avocado, Roasted Peppers & Hummus on a Whole Wheat Wrap

  • April Wrap

    Chickpeas, Celery, Red Onions, Dried Cranberries, Vegan Mayo & Iceberg Lettuce on a Whole Wheat Wrap

  • ALL DAY - Burgers/ Heroes

  • #1 Cheese Burger Deluxe $10.95

    American cheese with Lettuce, tomato & French Fries

  • #2 Bacon Cheese Burger Deluxe $12.95
  • #3 Burger With Swiss, Grilled Onions, Grilled Mushroom & BBQ Sauce $12.95

    Burger with Swiss, Grilled Onions, Grilled Mushrooms & BBQ Sauce

  • #4 Burger With Muenster Cheese & Avocado $12.95

    Burger with Muenster Cheese & Avocado

  • Grilled Chicken Hero

    Grilled Chicken, Muenster cheese, Avocado, Lettuce, Tomatoes and Ranch Dressing.

  • Cajun Chicken Hero

    Grilled Chicken, Onions, Peppers, Pepper Jack Cheese, Avocado, Lettuce, Tomatoes, chipotle mayo.

  • Big Hero

    Grilled chicken, Bacon, Muenster Cheese, Lettuce, tomato, Chipotle Mayo.

  • ALL DAY - Energy Shots

  • Ginger Lemon Shot

    Ginger & Lemon

  • Power Shot

    Ginger, Lemon, Cayenne Pepper & Turmeric

  • Booster Shot

    Beets, Garlic, Turmeric, Ginger & Lemon

  • Vitamin C Shot

    Grapefruit, Apple, Pineapple, Orange, Turmeric, Ginger & Lemon

  • ALL DAY - Sides/ Soups

  • French Fries $4.00
  • Chicken Empanada $3.00
  • Cheese Empanada $3.00
  • Sauce (1oz) $0.00
  • Chicken & Vegetables Soup
  • Lentil Soup
  • Yogurt Muffins $2.95
  • ALL DAY - Drinks

  • Can Soda $1.50
  • Ice Cup
  • Water Bottle $1.50
  • Iced Coffee
  • Healthy Fresh Combinations

  • A1- Mega Mix

    Strawberry, Pineapple & Papaya with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A2- Berry Happy

    Strawberry, Blueberry & Blackberry with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A3- Tropical Mix

    Mango, Banana & Pineapple with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A4- Mango Tropical

    Mango, Peach, Pineapple & Orange Juice

  • A5- The Secret

    Strawberry, Blueberry & Mango with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A6- Baby Bottle

    Strawberry, Banana & Blueberry with Evaporated Milk, Sugar Cinnamon & Vanilla

  • A7- Mango Tango

    Mango & Orange Juice

  • A8- Piña Colada

    Pineapple & Coco Lopez

  • Energy Smoothies To Start Your Day

  • B1- Incredible- Banana, Pineapple, Spinach, Apple & Cucumber
  • B2- Mango, Strawberry, Raisins, Oatmeal, Agave & Almond Milk
  • B3- Banana, Mango, Agave & Almond Milk
  • B4- Strawberry, Pineapple, Mango, Agave & Almond Milk
  • B5- Strawberry, Blueberry, Blackberry, Agave & Almond Milk
  • B6- Papaya, Apple, Spinach, Agave & Orange Juice
  • Morning Blast- Plum, Mango, Banana, Spinach, Ginger & Orange Juice
  • Best DATE Ever! - Banana, Dates, Pecans, Almond Milk & Cinnamon
  • Build Your Immune System

  • C1- Beet, Carrot & Orange
  • C2- Pineapple, Apple & Ginger
  • C3- Grapefruit, Orange, Pineapple & Ginger
  • C4- Beet, Carrot, Apple, Celery & Ginger
  • C5- Spinach, Beet, Carrot & Apple
  • Energizer- C6. Apple, Grapes, Cantaloupe, Watermelon, Ginger & Lemon
  • Go Green To Be Clean

  • D1- Aloe Vera, Pineapple, Apple & Cucumber
  • Green Juice -D2- Spinach, Kale, Apple, Cucumber, Celery & Pineapple
  • D3- Green Apple, Kale, Pineapple, Cucumber & Lemon
  • D4- Aloe Vera, Pineapple, Apple, Cucumber, Orange & Lime
  • D5- Cucumber, Celery, Apple & Lime
  • D6- Cucumber, Apple, Pineapple & Lime
  • Protein Smoothies

  • E1- Banana, Peanut Butter & Chocolate Protein

    Made with Almond Milk (No sugar Added)

  • E2- Pineapple, Banana, Spinach, Oatmeal & Protein

    Made with Almond Milk (No sugar Added)

  • E3- Strawberry, Blueberry, Almonds, Oatmeal & Protein

    Made with Almond Milk (No sugar Added)

  • E4- Banana, Blueberry, Peanut Butter & Protein

    Made with Almond Milk (No sugar Added)

  • E5- Papaya, Banana, Pecans, Almonds & Protein

    Made with Almond Milk (No sugar Added)

  • E6- Banana, Cantaloupe, Pecans, Walnuts & Protein

    Made with Almond Milk (No sugar Added)

  • E7- Blueberry, Banana, Oatmeal, Pecans & Protein

    Made with Almond Milk (No sugar Added)

  • E8- Mango, Banana, Peach, Peanut Butter & Protein

    Made with Almond Milk (No sugar Added)

  • E9- Mango, Apples, Kale, Peanut Butter & Protein

    Made with Almond Milk (No sugar Added)

  • E10- Beets, Blueberry, Kale, Peanut Butter & Protein

    Made with Almond Milk (No sugar Added)

  • Refreshers

  • Energizer- C6. Apple, Grapes, Cantaloupe, Watermelon, Ginger & Lemon
  • Orange Juice
  • Lemonade
  • Slushy Lemonade
  • Watermelon Lemonade

    Watermelon with Lime and a hint of Agave.

  • Picante Watermelon

    Watermelon, Tajin Powder & Agave *lightly spicy*

  • Cucumber Refresher

    Cucumber, Lime & Agave.

  • Create Smoothie/ Juice🍋🍓

  • 🍌Create Smoothie 🍓
  • Create Juice 🍏
  • Salads

  • Chicken Greek Salad $12.95

    Romaine Lettuce, Grilled Chicken, Black Olives, Tomatoes, Cucumbers, Red Onions, Peppers & Feta Cheese with Oil and Vinegar

  • Chicken Caesar Salad $8.95

    Romaine Lettuce, Grilled Chicken, Parmesan Cheese, Croutons & Ceasar Dressing

  • Create Salad $3.50
  • Fruit Salad
  • Wraps

  • California Wrap

    Grilled Chicken, Fresh Mozzarella, Avocado, Lettuce, Tomato & Ranch Dressing

  • Arizona Wrap

    Chicken Cutlet, Monterrey Cheese, Jalapeños Peppers, Lettuce, Tomato & Mayo

  • Monterrey Wrap

    Chicken Cutlet, Monterrey Cheese, Turkey Bacon, Lettuce & Chipotle Sauce

  • Caesar Wrap

    Grilled Chicken, Parmesan Cheese, Crispy Lettuce, Croutons & Caesar Dressing

  • Roma Wrap

    Grilled Chicken, Fresh Mozzarella, Sun-Dried Tomatoes, Fresh Spinach & Pesto Sauce

  • Italian Wrap

    Grilled Chicken, Cucumbers, Crispy Lettuce & Italian Dressing

  • Paninis

  • Pesto Panini

    Grilled Chicken, Fresh Mozzarella, Roasted Peppers & Pesto Sauce

  • Parmesan Panini

    Chicken Cutlet, Fresh Mozzarella, Parmesan Cheese & Marinara Sauce

  • Fajita Panini

    Grilled Chicken, Cheddar Cheese, Onions, Peppers, Cilantro & Salsa

  • Tuna Melt

    Tuna Salad, Mayo, Cheddar Cheese, Lettuce & Tomato

  • Tuscan Panini

    Fresh Mozzarella, Sun-Dried Tomatoes, Fresh Spinach & Pesto Sauce

  • Chicken Club

    Grilled Chicken, Bacon, Lettuce, Tomato & Mayo

  • Teriyaki Panini

    Grilled Chicken, Zucchini, Squash, Carrots, Mozzarella Cheese & Teriyaki Sauce

  • Quesadillas

  • Chicken Quesadilla

    Grilled Chicken & Mozzarella

  • Fajita Quesadilla

    Grilled Chicken, Cheddar Cheese, Onions, Peppers, Cilantro & Salsa

  • Vegetable Quesadilla

    Fresh Mozzarella, Grilled Zucchini, Squash & Carrots

  • Vegan Wraps

  • Kaiser Wrap

    Grilled Zucchini, Grilled Squash, Broccoli Rabe, Avocado & Chipotle Sauce on a Whole Wheat Wrap

  • Summer Time Wrap

    Veggie Patty, Cucumbers, Avocado, Roasted Peppers & Hummus on a Whole Wheat Wrap

  • April Wrap

    Chickpeas, Celery, Red Onions, Dried Cranberries, Vegan Mayo & Iceberg Lettuce on a Whole Wheat Wrap

  • Burgers/ Heroes

  • #1 Cheese Burger Deluxe $10.95

    American cheese with Lettuce, tomato & French Fries

  • #2 Bacon Cheese Burger Deluxe $12.95
  • #3 Burger With Swiss, Grilled Onions, Grilled Mushroom & BBQ Sauce $12.95

    Burger with Swiss, Grilled Onions, Grilled Mushrooms & BBQ Sauce

  • #4 Burger With Muenster Cheese & Avocado $12.95

    Burger with Muenster Cheese & Avocado

  • Grilled Chicken Hero

    Grilled Chicken, Muenster cheese, Avocado, Lettuce, Tomatoes and Ranch Dressing.

  • Cajun Chicken Hero

    Grilled Chicken, Onions, Peppers, Pepper Jack Cheese, Avocado, Lettuce, Tomatoes, chipotle mayo.

  • Big Hero

    Grilled chicken, Bacon, Muenster Cheese, Lettuce, tomato, Chipotle Mayo.

  • Energy Shots

  • Ginger Lemon Shot

    Ginger & Lemon

  • Power Shot

    Ginger, Lemon, Cayenne Pepper & Turmeric

  • Booster Shot

    Beets, Garlic, Turmeric, Ginger & Lemon

  • Vitamin C Shot

    Grapefruit, Apple, Pineapple, Orange, Turmeric, Ginger & Lemon

  • Sides/ Soups

  • French Fries $4.00
  • Chicken Empanada $3.00
  • Cheese Empanada $3.00
  • Sauce (1oz) $0.00
  • Chicken & Vegetables Soup
  • Lentil Soup
  • Yogurt Muffins $2.95
  • Drinks

  • Can Soda $1.50
  • Ice Cup
  • Water Bottle $1.50
  • Iced Coffee

Healthy Fresh Details

  • Service options

  • Delivery
  • Takeout
  • Dine-in
  • Highlights

  • Great tea selection
  • Popular for

  • Breakfast
  • Lunch
  • Dinner
  • Solo dining
  • Accessibility

  • Wheelchair accessible entrance
  • Offerings

  • Coffee
  • Healthy options
  • Quick bite
  • Small plates
  • Vegan options
  • Vegetarian options
  • Dining options

  • Breakfast
  • Brunch
  • Lunch
  • Dinner
  • Dessert
  • Table service
  • Atmosphere

  • Casual
  • Cozy
  • Quiet
  • Trendy
  • Crowd

  • College students
  • Planning

  • Accepts reservations
  • Payments

  • Credit cards
  • Debit cards
  • NFC mobile payments
  • Credit cards
  • Children

  • Good for kids
  • Parking

  • Paid street parking

Healthy Fresh Photos

Healthy Fresh Picture 1Healthy Fresh Picture 2Healthy Fresh Picture 3Healthy Fresh Picture 4Healthy Fresh Picture 5Healthy Fresh Picture 6Healthy Fresh Picture 7Healthy Fresh Picture 8Healthy Fresh Picture 9Healthy Fresh Picture 10

Healthy Fresh Location

Healthy Fresh

1033 Morris Park Ave, Bronx, NY 10461, USA

Healthy Fresh Reviews

An average rating of ★4.4 from 336 user reviews.

priceswrappanininameempanadasdeliveryfriespeanut butterto gocheese empanada

★ 5★ 4★ 3★ 2★ 1

More restaurants near me

  • Nana's KitchenNana's Kitchen4.0 (210 reviews)

    1809 Hone Ave, Bronx, NY 10461, USA

  • Morris Park Bake ShopMorris Park Bake Shop4.0 (338 reviews)

    1007 Morris Park Ave, Bronx, NY 10462, USA

  • Lucianou2019s PizzaLucianou2019s Pizza4.0 (265 reviews)

    1005 Morris Park Ave # A, Bronx, NY 10462, USA

  • La Masa RestaurantLa Masa Restaurant4.0 (1360 reviews)

    1000 Morris Park Ave, Bronx, NY 10462, USA

  • JSR DeliJSR Deli4.0 (59 reviews)

    994 Morris Park Ave, Bronx, NY 10462, USA

  • Scaglione Brothers Bakery & DeliScaglione Brothers Bakery & Deli4.0 (129 reviews)

    1078 Morris Park Ave, Bronx, NY 10461, USA

  • Prizreni GrillPrizreni Grill4.0 (54 reviews)

    1080 Morris Park Ave, Bronx, NY 10461, USA

  • Patricia's of Morris ParkPatricia's of Morris Park4.0 (365 reviews)

    1082 Morris Park Ave, Bronx, NY 10461, USA

  • Dunkin'Dunkin'4.0 (476 reviews)

    1090 Morris Park Ave, Bronx, NY 10462, USA

  • Salam DeliSalam Deli4.0 (21 reviews)

    939 Morris Park Ave, Bronx, NY 10462, USA

  • Smoothie stationSmoothie station4.0 (73 reviews)

    937 Morris Park Ave, Bronx, NY 10462, USA

  • Universe CafeUniverse Cafe4.0 (26 reviews)

    929 Morris Park Ave, Bronx, NY 10462, USA

  • Categories

    Top Visited Sites

    Trending Dining Insights Posts