Healthy Fresh Introduce
Welcome to the ultimate guide to **Healthy Fresh**, a prominent name in the **Bronx, New York**, for fresh, nutritious, and convenient dining. In a bustling metropolis like NYC, finding quick, healthy food that doesn't compromise on flavor or quality can be a challenge. Healthy Fresh steps in as a reliable local solution, operating as a **Health food restaurant**, **Juice shop**, and **Delivery Restaurant** rolled into one. Whether you're a busy professional, a dedicated student, or a health-conscious resident, Healthy Fresh aims to make wholesome eating accessible. This overview will detail everything you need to know about this local gem, from its menu offerings to its accessibility and why it’s worth adding to your dining rotation.
Healthy Fresh isn't just a place to grab a bite; it's a destination for those prioritizing a vibrant and balanced diet. They’ve tailored their concept to cater to the diverse, fast-paced needs of the New York community, offering a broad spectrum of **healthy options**, **vegan options**, and **vegetarian options** that go beyond the typical deli fare. Known for being **popular for** Breakfast, Lunch, and Dinner, they serve customers looking for a **quick bite** or a satisfying, complete meal. For local users in the Bronx and surrounding NYC areas, this establishment represents a great way to maintain a healthy lifestyle without sacrificing convenience.
## Location and Accessibility for New Yorkers
Healthy Fresh is strategically located in the heart of the Bronx, making it a truly local establishment for many residents and commuters. You can find their physical location at **1033 Morris Park Ave, Bronx, NY 10461, USA**. This specific address places them in a high-traffic area, ensuring they are a convenient stop for neighborhood residents and those traveling through the Morris Park area.
For those planning a visit, the establishment focuses on accessibility. It offers a **Wheelchair accessible entrance**, ensuring it can accommodate all members of the community. If you plan on driving, be aware that there is **Paid street parking** available nearby, which is typical for this area of NYC. The overall atmosphere is described as **Casual**, **Cozy**, **Quiet**, and sometimes **Trendy**, creating a welcoming environment for everyone, including **College students** and families, as the location is also deemed **Good for kids**. However, for those who prefer the utmost convenience—a must-have for any busy New Yorker—their designation as a **Delivery Restaurant** is paramount. You can order directly to your home or office, making healthy eating effortless no matter where you are in their delivery zone. They also offer **Takeout** and a comfortable **Dine-in** option.
## Services Offered at Healthy Fresh
Healthy Fresh provides a comprehensive range of dining and service options designed to fit the NYC lifestyle, serving customers from morning until evening.
- **Delivery:** The core service, providing a convenient way for residents to get fresh, healthy meals delivered right to their door.
- **Takeout:** Perfect for grabbing a meal, juice, or smoothie on the go for those who are in the area.
- **Dine-in:** Offers a comfortable and casual spot for patrons to sit, relax, and enjoy their food and drinks.
- **Extensive Breakfast Menu:** Catering to the early risers with options like Pancakes, various Egg Sandwiches, and an array of flavorful Hot Oatmeals.
- **Juice Shop Specialization:** Focused on fresh-pressed juices and energizing smoothies, including specific categories like "Go Green To Be Clean" and "Build Your Immune System."
- **All-Day Healthy Menu:** Serving up fresh Salads (like Chicken Greek and Caesar), flavorful Wraps (including Vegan options), Paninis, and even Burgers/Heroes.
- **Multiple Payment Options:** Accepting **Credit cards**, **Debit cards**, and **NFC mobile payments** for a seamless transaction.
- **Dining Options:** Available for **Breakfast**, **Brunch**, **Lunch**, **Dinner**, and **Dessert**.
## Features and Highlights of the Menu
The menu at Healthy Fresh is built around variety, nutritional content, and catering to specific dietary preferences, ensuring everyone in the New York community can find something they love.
- **Great Tea Selection:** Highlighted as a key feature, perfect for tea aficionados looking for a warm or iced beverage.
- **Rich Array of Smoothies & Juices:** The menu is incredibly varied, featuring over 20 unique blends across categories like **Energy Smoothies**, **Protein Smoothies** (e.g., E1- Banana, Peanut Butter & Chocolate Protein), and specialized juices designed to **Build Your Immune System** (e.g., C4- Beet, Carrot, Apple, Celery & Ginger).
- **Customization:** Customers can **Create Smoothie/ Juice** or **Create Salad**, offering flexibility and control over ingredients. The Salad base starts at a reasonable price, allowing for personalization.
- **High-Protein and Vegan/Vegetarian Focus:** The **Offerings** include **Healthy options**, **Vegan options**, and **Vegetarian options** throughout the menu, from **Vegan Wraps** (Kaiser Wrap, Summer Time Wrap) to protein-packed wraps and paninis.
- **All-Day Wraps and Paninis:** A strong selection of items like the California Wrap, Italian Wrap, Pesto Panini, and Fajita Panini provides substantial options for lunch and dinner.
- **Quick Bites and Sides:** Alongside full meals, they offer **Small plates**, **Quick bite** items, and affordable sides like **Chicken Empanada** and **French Fries**.
## Contact Information
To connect with Healthy Fresh for orders, inquiries, or more information, here is the essential contact data for local users in the New York region:
- **Address:** 1033 Morris Park Ave, Bronx, NY 10461, USA
- **Phone (Landline):** (718) 684-6411
- **Phone (Mobile/Direct):** +1 718-684-6411
## What is Worth Choosing at Healthy Fresh
For anyone in the Bronx or surrounding areas seeking a genuinely healthy and fresh meal option, Healthy Fresh presents a compelling choice. The core value here is in the name: the commitment to using **fresh fruits and vegetables** for their expansive juice and smoothie menu. A customer review highlights this, noting, "The name of the place is true. **Healthy and fresh**. The fruits and vegetables are fresh, the place is spotless." This dedication to quality is a significant draw, particularly in the NYC food landscape.
The variety on the menu ensures that you can find a healthy option no matter your craving. Their specialization as a **Juice shop** is a standout feature; with categories like **Healthy Fresh Combinations** (A1- Mega Mix, A8- Piña Colada) and targeted immune-boosting blends, they are a top contender for the best source of cold-pressed goodness in the area. The **Protein Smoothies** section alone—featuring 10 different options—is perfect for fitness enthusiasts or those needing a substantial, on-the-go meal replacement.
While one customer review noted an issue with the portion size and flavor of a specific item (Chicken Caesar Salad Wrap), another review provides a strong counterbalance, praising the service, knowledge of the staff, and the overall quality of the diverse items they ordered, stating, "Everything I order I’m so happy with. I’ve gotten **Salads, Smoothies, Juices** and I’m always pleased." This suggests that the real value lies in their signature healthy options, particularly the vast array of juices and smoothies, which are consistently praised for being both **fresh** and high **quality** for a reasonable price. Given the convenience of **Delivery** and the commitment to **Healthy options**, **Vegan options**, and **Vegetarian options**, Healthy Fresh offers a valuable service to New Yorkers looking to eat well without the fuss. It's an excellent local resource for a quick, nutritious, and convenient healthy fix.
Healthy Fresh Food & drink
BREAKFAST - Breakfast
- Coffee
- BREAKFAST COMBO $5.50
- Yogurt Muffins $2.95
- Tea
- Pancakes
- Iced Coffee
- English Muffin Sandwich $4.50
- Bagel With Cream Cheese (Plain Bagel Only) $3.50
- Create Egg Sandwich
BREAKFAST - Breakfast Wraps
- #1 Egg Whites, Turkey Sausage & Avocado $7.99
- #2 Egg Whites, Turkey Bacon & Avocado $7.99
- #3 Egg Whites, Bacon, Swiis & Avocado $7.99
- #4 Egg Whites, Spinach, Broccoli & Avocado $7.99
- #5 Egg Whites, Turkey Bacon, Cheddar Cheese & Salsa $7.99
- #6 Egg Whites, Grilled Chicken, Monterrey Jack Cheese & Chipotle Mayo $7.99
BREAKFAST - Hot Oatmeals
- #1 Strawberry, Banana, Granola & Cinnamon $5.49
- #2 Walnuts, Pecans, Almonds & Agave $5.49
- #3 Peanut Butter, Apples & Agave $5.49
- #4 Dried Cranberries, Raisins, Apples & Agave $5.49
- #5 Strawberry, Banana, Blueberry & Cinnamon $5.49
- #6 Banana, Chia Seeds & Agave $5.49
Breakfast
- Coffee
- BREAKFAST COMBO $5.50
- Yogurt Muffins $2.95
- Tea
- Pancakes
- Iced Coffee
- English Muffin Sandwich $4.50
- Bagel With Cream Cheese (Plain Bagel Only) $3.50
- Create Egg Sandwich
Breakfast Wraps
- #1 Egg Whites, Turkey Sausage & Avocado $7.99
- #2 Egg Whites, Turkey Bacon & Avocado $7.99
- #3 Egg Whites, Bacon, Swiis & Avocado $7.99
- #4 Egg Whites, Spinach, Broccoli & Avocado $7.99
- #5 Egg Whites, Turkey Bacon, Cheddar Cheese & Salsa $7.99
- #6 Egg Whites, Grilled Chicken, Monterrey Jack Cheese & Chipotle Mayo $7.99
Hot Oatmeals
- #1 Strawberry, Banana, Granola & Cinnamon $5.49
- #2 Walnuts, Pecans, Almonds & Agave $5.49
- #3 Peanut Butter, Apples & Agave $5.49
- #4 Dried Cranberries, Raisins, Apples & Agave $5.49
- #5 Strawberry, Banana, Blueberry & Cinnamon $5.49
- #6 Banana, Chia Seeds & Agave $5.49
ALL DAY - Healthy Fresh Combinations
- A1- Mega Mix
Strawberry, Pineapple & Papaya with Evaporated Milk, Sugar Cinnamon & Vanilla
- A2- Berry Happy
Strawberry, Blueberry & Blackberry with Evaporated Milk, Sugar Cinnamon & Vanilla
- A3- Tropical Mix
Mango, Banana & Pineapple with Evaporated Milk, Sugar Cinnamon & Vanilla
- A4- Mango Tropical
Mango, Peach, Pineapple & Orange Juice
- A5- The Secret
Strawberry, Blueberry & Mango with Evaporated Milk, Sugar Cinnamon & Vanilla
- A6- Baby Bottle
Strawberry, Banana & Blueberry with Evaporated Milk, Sugar Cinnamon & Vanilla
- A7- Mango Tango
Mango & Orange Juice
- A8- Piña Colada
Pineapple & Coco Lopez
ALL DAY - Energy Smoothies To Start Your Day
- B1- Incredible- Banana, Pineapple, Spinach, Apple & Cucumber
- B2- Mango, Strawberry, Raisins, Oatmeal, Agave & Almond Milk
- B3- Banana, Mango, Agave & Almond Milk
- B4- Strawberry, Pineapple, Mango, Agave & Almond Milk
- B5- Strawberry, Blueberry, Blackberry, Agave & Almond Milk
- B6- Papaya, Apple, Spinach, Agave & Orange Juice
- Morning Blast- Plum, Mango, Banana, Spinach, Ginger & Orange Juice
- Best DATE Ever! - Banana, Dates, Pecans, Almond Milk & Cinnamon
ALL DAY - Build Your Immune System
- C1- Beet, Carrot & Orange
- C2- Pineapple, Apple & Ginger
- C3- Grapefruit, Orange, Pineapple & Ginger
- C4- Beet, Carrot, Apple, Celery & Ginger
- C5- Spinach, Beet, Carrot & Apple
- Energizer- C6. Apple, Grapes, Cantaloupe, Watermelon, Ginger & Lemon
ALL DAY - Go Green To Be Clean
- D1- Aloe Vera, Pineapple, Apple & Cucumber
- Green Juice -D2- Spinach, Kale, Apple, Cucumber, Celery & Pineapple
- D3- Green Apple, Kale, Pineapple, Cucumber & Lemon
- D4- Aloe Vera, Pineapple, Apple, Cucumber, Orange & Lime
- D5- Cucumber, Celery, Apple & Lime
- D6- Cucumber, Apple, Pineapple & Lime
ALL DAY - Protein Smoothies
- E1- Banana, Peanut Butter & Chocolate Protein
Made with Almond Milk (No sugar Added)
- E2- Pineapple, Banana, Spinach, Oatmeal & Protein
Made with Almond Milk (No sugar Added)
- E3- Strawberry, Blueberry, Almonds, Oatmeal & Protein
Made with Almond Milk (No sugar Added)
- E4- Banana, Blueberry, Peanut Butter & Protein
Made with Almond Milk (No sugar Added)
- E5- Papaya, Banana, Pecans, Almonds & Protein
Made with Almond Milk (No sugar Added)
- E6- Banana, Cantaloupe, Pecans, Walnuts & Protein
Made with Almond Milk (No sugar Added)
- E7- Blueberry, Banana, Oatmeal, Pecans & Protein
Made with Almond Milk (No sugar Added)
- E8- Mango, Banana, Peach, Peanut Butter & Protein
Made with Almond Milk (No sugar Added)
- E9- Mango, Apples, Kale, Peanut Butter & Protein
Made with Almond Milk (No sugar Added)
- E10- Beets, Blueberry, Kale, Peanut Butter & Protein
Made with Almond Milk (No sugar Added)
ALL DAY - Refreshers
- Energizer- C6. Apple, Grapes, Cantaloupe, Watermelon, Ginger & Lemon
- Orange Juice
- Lemonade
- Slushy Lemonade
- Watermelon Lemonade
Watermelon with Lime and a hint of Agave.
- Picante Watermelon
Watermelon, Tajin Powder & Agave *lightly spicy*
- Cucumber Refresher
Cucumber, Lime & Agave.
ALL DAY - Create Smoothie/ Juice🍋🍓
- 🍌Create Smoothie 🍓
- Create Juice 🍏
ALL DAY - Salads
- Chicken Greek Salad $12.95
Romaine Lettuce, Grilled Chicken, Black Olives, Tomatoes, Cucumbers, Red Onions, Peppers & Feta Cheese with Oil and Vinegar
- Chicken Caesar Salad $8.95
Romaine Lettuce, Grilled Chicken, Parmesan Cheese, Croutons & Ceasar Dressing
- Create Salad $3.50
- Fruit Salad
ALL DAY - Wraps
- California Wrap
Grilled Chicken, Fresh Mozzarella, Avocado, Lettuce, Tomato & Ranch Dressing
- Arizona Wrap
Chicken Cutlet, Monterrey Cheese, Jalapeños Peppers, Lettuce, Tomato & Mayo
- Monterrey Wrap
Chicken Cutlet, Monterrey Cheese, Turkey Bacon, Lettuce & Chipotle Sauce
- Caesar Wrap
Grilled Chicken, Parmesan Cheese, Crispy Lettuce, Croutons & Caesar Dressing
- Roma Wrap
Grilled Chicken, Fresh Mozzarella, Sun-Dried Tomatoes, Fresh Spinach & Pesto Sauce
- Italian Wrap
Grilled Chicken, Cucumbers, Crispy Lettuce & Italian Dressing
ALL DAY - Paninis
- Pesto Panini
Grilled Chicken, Fresh Mozzarella, Roasted Peppers & Pesto Sauce
- Parmesan Panini
Chicken Cutlet, Fresh Mozzarella, Parmesan Cheese & Marinara Sauce
- Fajita Panini
Grilled Chicken, Cheddar Cheese, Onions, Peppers, Cilantro & Salsa
- Tuna Melt
Tuna Salad, Mayo, Cheddar Cheese, Lettuce & Tomato
- Tuscan Panini
Fresh Mozzarella, Sun-Dried Tomatoes, Fresh Spinach & Pesto Sauce
- Chicken Club
Grilled Chicken, Bacon, Lettuce, Tomato & Mayo
- Teriyaki Panini
Grilled Chicken, Zucchini, Squash, Carrots, Mozzarella Cheese & Teriyaki Sauce
ALL DAY - Quesadillas
- Chicken Quesadilla
Grilled Chicken & Mozzarella
- Fajita Quesadilla
Grilled Chicken, Cheddar Cheese, Onions, Peppers, Cilantro & Salsa
- Vegetable Quesadilla
Fresh Mozzarella, Grilled Zucchini, Squash & Carrots
ALL DAY - Vegan Wraps
- Kaiser Wrap
Grilled Zucchini, Grilled Squash, Broccoli Rabe, Avocado & Chipotle Sauce on a Whole Wheat Wrap
- Summer Time Wrap
Veggie Patty, Cucumbers, Avocado, Roasted Peppers & Hummus on a Whole Wheat Wrap
- April Wrap
Chickpeas, Celery, Red Onions, Dried Cranberries, Vegan Mayo & Iceberg Lettuce on a Whole Wheat Wrap
ALL DAY - Burgers/ Heroes
- #1 Cheese Burger Deluxe $10.95
American cheese with Lettuce, tomato & French Fries
- #2 Bacon Cheese Burger Deluxe $12.95
- #3 Burger With Swiss, Grilled Onions, Grilled Mushroom & BBQ Sauce $12.95
Burger with Swiss, Grilled Onions, Grilled Mushrooms & BBQ Sauce
- #4 Burger With Muenster Cheese & Avocado $12.95
Burger with Muenster Cheese & Avocado
- Grilled Chicken Hero
Grilled Chicken, Muenster cheese, Avocado, Lettuce, Tomatoes and Ranch Dressing.
- Cajun Chicken Hero
Grilled Chicken, Onions, Peppers, Pepper Jack Cheese, Avocado, Lettuce, Tomatoes, chipotle mayo.
- Big Hero
Grilled chicken, Bacon, Muenster Cheese, Lettuce, tomato, Chipotle Mayo.
ALL DAY - Energy Shots
- Ginger Lemon Shot
Ginger & Lemon
- Power Shot
Ginger, Lemon, Cayenne Pepper & Turmeric
- Booster Shot
Beets, Garlic, Turmeric, Ginger & Lemon
- Vitamin C Shot
Grapefruit, Apple, Pineapple, Orange, Turmeric, Ginger & Lemon
ALL DAY - Sides/ Soups
- French Fries $4.00
- Chicken Empanada $3.00
- Cheese Empanada $3.00
- Sauce (1oz) $0.00
- Chicken & Vegetables Soup
- Lentil Soup
- Yogurt Muffins $2.95
ALL DAY - Drinks
- Can Soda $1.50
- Ice Cup
- Water Bottle $1.50
- Iced Coffee
Healthy Fresh Combinations
- A1- Mega Mix
Strawberry, Pineapple & Papaya with Evaporated Milk, Sugar Cinnamon & Vanilla
- A2- Berry Happy
Strawberry, Blueberry & Blackberry with Evaporated Milk, Sugar Cinnamon & Vanilla
- A3- Tropical Mix
Mango, Banana & Pineapple with Evaporated Milk, Sugar Cinnamon & Vanilla
- A4- Mango Tropical
Mango, Peach, Pineapple & Orange Juice
- A5- The Secret
Strawberry, Blueberry & Mango with Evaporated Milk, Sugar Cinnamon & Vanilla
- A6- Baby Bottle
Strawberry, Banana & Blueberry with Evaporated Milk, Sugar Cinnamon & Vanilla
- A7- Mango Tango
Mango & Orange Juice
- A8- Piña Colada
Pineapple & Coco Lopez
Energy Smoothies To Start Your Day
- B1- Incredible- Banana, Pineapple, Spinach, Apple & Cucumber
- B2- Mango, Strawberry, Raisins, Oatmeal, Agave & Almond Milk
- B3- Banana, Mango, Agave & Almond Milk
- B4- Strawberry, Pineapple, Mango, Agave & Almond Milk
- B5- Strawberry, Blueberry, Blackberry, Agave & Almond Milk
- B6- Papaya, Apple, Spinach, Agave & Orange Juice
- Morning Blast- Plum, Mango, Banana, Spinach, Ginger & Orange Juice
- Best DATE Ever! - Banana, Dates, Pecans, Almond Milk & Cinnamon
Build Your Immune System
- C1- Beet, Carrot & Orange
- C2- Pineapple, Apple & Ginger
- C3- Grapefruit, Orange, Pineapple & Ginger
- C4- Beet, Carrot, Apple, Celery & Ginger
- C5- Spinach, Beet, Carrot & Apple
- Energizer- C6. Apple, Grapes, Cantaloupe, Watermelon, Ginger & Lemon
Go Green To Be Clean
- D1- Aloe Vera, Pineapple, Apple & Cucumber
- Green Juice -D2- Spinach, Kale, Apple, Cucumber, Celery & Pineapple
- D3- Green Apple, Kale, Pineapple, Cucumber & Lemon
- D4- Aloe Vera, Pineapple, Apple, Cucumber, Orange & Lime
- D5- Cucumber, Celery, Apple & Lime
- D6- Cucumber, Apple, Pineapple & Lime
Protein Smoothies
- E1- Banana, Peanut Butter & Chocolate Protein
Made with Almond Milk (No sugar Added)
- E2- Pineapple, Banana, Spinach, Oatmeal & Protein
Made with Almond Milk (No sugar Added)
- E3- Strawberry, Blueberry, Almonds, Oatmeal & Protein
Made with Almond Milk (No sugar Added)
- E4- Banana, Blueberry, Peanut Butter & Protein
Made with Almond Milk (No sugar Added)
- E5- Papaya, Banana, Pecans, Almonds & Protein
Made with Almond Milk (No sugar Added)
- E6- Banana, Cantaloupe, Pecans, Walnuts & Protein
Made with Almond Milk (No sugar Added)
- E7- Blueberry, Banana, Oatmeal, Pecans & Protein
Made with Almond Milk (No sugar Added)
- E8- Mango, Banana, Peach, Peanut Butter & Protein
Made with Almond Milk (No sugar Added)
- E9- Mango, Apples, Kale, Peanut Butter & Protein
Made with Almond Milk (No sugar Added)
- E10- Beets, Blueberry, Kale, Peanut Butter & Protein
Made with Almond Milk (No sugar Added)
Refreshers
- Energizer- C6. Apple, Grapes, Cantaloupe, Watermelon, Ginger & Lemon
- Orange Juice
- Lemonade
- Slushy Lemonade
- Watermelon Lemonade
Watermelon with Lime and a hint of Agave.
- Picante Watermelon
Watermelon, Tajin Powder & Agave *lightly spicy*
- Cucumber Refresher
Cucumber, Lime & Agave.
Create Smoothie/ Juice🍋🍓
- 🍌Create Smoothie 🍓
- Create Juice 🍏
Salads
- Chicken Greek Salad $12.95
Romaine Lettuce, Grilled Chicken, Black Olives, Tomatoes, Cucumbers, Red Onions, Peppers & Feta Cheese with Oil and Vinegar
- Chicken Caesar Salad $8.95
Romaine Lettuce, Grilled Chicken, Parmesan Cheese, Croutons & Ceasar Dressing
- Create Salad $3.50
- Fruit Salad
Wraps
- California Wrap
Grilled Chicken, Fresh Mozzarella, Avocado, Lettuce, Tomato & Ranch Dressing
- Arizona Wrap
Chicken Cutlet, Monterrey Cheese, Jalapeños Peppers, Lettuce, Tomato & Mayo
- Monterrey Wrap
Chicken Cutlet, Monterrey Cheese, Turkey Bacon, Lettuce & Chipotle Sauce
- Caesar Wrap
Grilled Chicken, Parmesan Cheese, Crispy Lettuce, Croutons & Caesar Dressing
- Roma Wrap
Grilled Chicken, Fresh Mozzarella, Sun-Dried Tomatoes, Fresh Spinach & Pesto Sauce
- Italian Wrap
Grilled Chicken, Cucumbers, Crispy Lettuce & Italian Dressing
Paninis
- Pesto Panini
Grilled Chicken, Fresh Mozzarella, Roasted Peppers & Pesto Sauce
- Parmesan Panini
Chicken Cutlet, Fresh Mozzarella, Parmesan Cheese & Marinara Sauce
- Fajita Panini
Grilled Chicken, Cheddar Cheese, Onions, Peppers, Cilantro & Salsa
- Tuna Melt
Tuna Salad, Mayo, Cheddar Cheese, Lettuce & Tomato
- Tuscan Panini
Fresh Mozzarella, Sun-Dried Tomatoes, Fresh Spinach & Pesto Sauce
- Chicken Club
Grilled Chicken, Bacon, Lettuce, Tomato & Mayo
- Teriyaki Panini
Grilled Chicken, Zucchini, Squash, Carrots, Mozzarella Cheese & Teriyaki Sauce
Quesadillas
- Chicken Quesadilla
Grilled Chicken & Mozzarella
- Fajita Quesadilla
Grilled Chicken, Cheddar Cheese, Onions, Peppers, Cilantro & Salsa
- Vegetable Quesadilla
Fresh Mozzarella, Grilled Zucchini, Squash & Carrots
Vegan Wraps
- Kaiser Wrap
Grilled Zucchini, Grilled Squash, Broccoli Rabe, Avocado & Chipotle Sauce on a Whole Wheat Wrap
- Summer Time Wrap
Veggie Patty, Cucumbers, Avocado, Roasted Peppers & Hummus on a Whole Wheat Wrap
- April Wrap
Chickpeas, Celery, Red Onions, Dried Cranberries, Vegan Mayo & Iceberg Lettuce on a Whole Wheat Wrap
Burgers/ Heroes
- #1 Cheese Burger Deluxe $10.95
American cheese with Lettuce, tomato & French Fries
- #2 Bacon Cheese Burger Deluxe $12.95
- #3 Burger With Swiss, Grilled Onions, Grilled Mushroom & BBQ Sauce $12.95
Burger with Swiss, Grilled Onions, Grilled Mushrooms & BBQ Sauce
- #4 Burger With Muenster Cheese & Avocado $12.95
Burger with Muenster Cheese & Avocado
- Grilled Chicken Hero
Grilled Chicken, Muenster cheese, Avocado, Lettuce, Tomatoes and Ranch Dressing.
- Cajun Chicken Hero
Grilled Chicken, Onions, Peppers, Pepper Jack Cheese, Avocado, Lettuce, Tomatoes, chipotle mayo.
- Big Hero
Grilled chicken, Bacon, Muenster Cheese, Lettuce, tomato, Chipotle Mayo.
Energy Shots
- Ginger Lemon Shot
Ginger & Lemon
- Power Shot
Ginger, Lemon, Cayenne Pepper & Turmeric
- Booster Shot
Beets, Garlic, Turmeric, Ginger & Lemon
- Vitamin C Shot
Grapefruit, Apple, Pineapple, Orange, Turmeric, Ginger & Lemon
Sides/ Soups
- French Fries $4.00
- Chicken Empanada $3.00
- Cheese Empanada $3.00
- Sauce (1oz) $0.00
- Chicken & Vegetables Soup
- Lentil Soup
- Yogurt Muffins $2.95
Drinks
- Can Soda $1.50
- Ice Cup
- Water Bottle $1.50
- Iced Coffee
Healthy Fresh Details
Service options
- Delivery
- Takeout
- Dine-in
Highlights
- Great tea selection
Popular for
- Breakfast
- Lunch
- Dinner
- Solo dining
Accessibility
- Wheelchair accessible entrance
Offerings
- Coffee
- Healthy options
- Quick bite
- Small plates
- Vegan options
- Vegetarian options
Dining options
- Breakfast
- Brunch
- Lunch
- Dinner
- Dessert
- Table service
Atmosphere
- Casual
- Cozy
- Quiet
- Trendy
Crowd
- College students
Planning
- Accepts reservations
Payments
- Credit cards
- Debit cards
- NFC mobile payments
- Credit cards
Children
- Good for kids
Parking
- Paid street parking
Healthy Fresh Photos










Healthy Fresh Location
Healthy Fresh
1033 Morris Park Ave, Bronx, NY 10461, USA
Healthy Fresh Reviews
priceswrappanininameempanadasdeliveryfriespeanut butterto gocheese empanada
★ 5★ 4★ 3★ 2★ 1Ordered here for the first time because I was craving a chicken caesar salad wrap. But I was VERY disappointed not only in the flavors of the food, but in the quantity for the price.This wrap was $13+ because I added French fries (which were $1.50). You can eat the wrap in 3 bites! The chicken was super dry and lacked flavor, the wrap barely had any dressing and tasted burnt. Absolutely terrible experience.. In the picture you will see half the wrap, and it’s smaller than the ginger ale. Barely had any filling. Do not order from here unless you want really small portions of mediocre food.Plenty of deli’s in the area that make better food, bigger portions & great pricing. This is what I get for being lazy and not heading to a worthy location.The healthy fresh owners should be ashamed of the mediocrity.
August 07 · Vianny GutierrezThe name of the place is true. Healthy and fresh. The fruits and vegetables are fresh, the place is spotless. The people there are smart about the menu and friendly. Service is quick. They’re polite and forward with handling Bronx customers. Everything I order I’m so happy with. I’ve gotten Salads, Smoothies, Juices and I’m always pleased. Today I got a Toasted corn muffin with butter and that was sooo yummy. They have seating. The prices are on point for top quality food and service.
June 07 · Kimberly RobinsonI had a great experience! The service was excellent — fast, friendly, and professional. Highly recommend!
March 16 · ༺ ÑÛRÛŁ Aɱιɳ ༻Save yourself the disappointment and go literally anywhere else. The prices here are absurd compared to what you actually receive. The portions are insultingly small, and it feels like a complete rip-off. For what they charge, this place simply does not deliver.
September 24 · Mensur CekicI love how this place looks. The glass wall in the early morning looks stunning. The place looks appealing. There's always plenty of staff to get you your order quick. I was sick so I went here in the early winter. I hadn't had breakfast and I ordered a chocolate chip muffin. The way they toasted it and buttered it is still the best muffin I ever had. I can't believe I haven't been back. It was amazing. This place is great.
September 04 · Morris Traveler
More restaurants near me
Nana's Kitchen4.0 (210 reviews)1809 Hone Ave, Bronx, NY 10461, USA
Morris Park Bake Shop4.0 (338 reviews)1007 Morris Park Ave, Bronx, NY 10462, USA
Lucianou2019s Pizza4.0 (265 reviews)1005 Morris Park Ave # A, Bronx, NY 10462, USA
La Masa Restaurant4.0 (1360 reviews)1000 Morris Park Ave, Bronx, NY 10462, USA
JSR Deli4.0 (59 reviews)994 Morris Park Ave, Bronx, NY 10462, USA
Scaglione Brothers Bakery & Deli4.0 (129 reviews)1078 Morris Park Ave, Bronx, NY 10461, USA
Prizreni Grill4.0 (54 reviews)1080 Morris Park Ave, Bronx, NY 10461, USA
Patricia's of Morris Park4.0 (365 reviews)1082 Morris Park Ave, Bronx, NY 10461, USA
Dunkin'4.0 (476 reviews)1090 Morris Park Ave, Bronx, NY 10462, USA
Salam Deli4.0 (21 reviews)939 Morris Park Ave, Bronx, NY 10462, USA
Smoothie station4.0 (73 reviews)937 Morris Park Ave, Bronx, NY 10462, USA
Universe Cafe4.0 (26 reviews)929 Morris Park Ave, Bronx, NY 10462, USA
Categories
Top Visited Sites
Capizzi4.0 (2267 reviews)
Moore Wine4.0 (2 reviews)
Gyro King5.0 (1 reviews)
Derek food truck4.0 (91 reviews)
El Rancho De Mexico3.0 (87 reviews)
Rakuzen AYCE Sushi3.0 (1036 reviews)Top restaurants Searches
Trending Dining Insights Posts
How Ice Cream Shops Are Incorporating Global Flavors Into Their Menu
How Brunch Restaurants Are Creating Seasonal Menus That Delight Guests
How Brunch Restaurants Are Elevating Menu Items With Unique Flavor Pairings
How Brunch Restaurants Are Introducing Unique Beverage Pairings to Menus
Discovering Barbecue Restaurants That Celebrate Regional Traditions
Exploring Breakfast Restaurants That Experiment With International Fusion Dishes
