Legacy Deli & Convenience Introduce
Introduction / Overview
For New Jersey residents in East Rutherford and the surrounding Bergen County area, Legacy Deli & Convenience stands as a true local institution. Situated on Paterson Avenue, this isn't just a place to grab a quick snack; it's a versatile establishment that serves up everything from essential deli cold cuts to substantial, flavorful hot meals. Legacy Deli & Convenience has earned its reputation by focusing on quality ingredients, fast service, and a broad menu that covers breakfast, lunch, and dinner cravings.
In the heart of North Jersey, a reliable deli is a cornerstone of the community, and Legacy Deli steps up to the plate. Whether you’re stopping in before work for a classic breakfast sandwich, looking for premium Boar's Head cold cuts for a weekend gathering, or craving a hearty Halal-style platter, this spot is ready to deliver. The convenience factor is built right into the name—it’s designed for the busy local user who needs a quality meal in a hurry. The business is well-regarded for providing reasonable prices and good value for the area, making it a frequent choice for a quick visit.
A key element of their offering is the balance between classic American deli staples, such as the Bacon, Egg & Cheese, and popular modern street food, particularly their well-regarded Halal Platters and the quintessential Philly Cheesesteak. This diversity ensures that whether you're a creature of habit or looking to try something new, Legacy Deli & Convenience has something to satisfy your appetite. The atmosphere is centered around quick, efficient service, making it ideal for takeout, delivery, or a brief in-store stop.
Location and Accessibility
Legacy Deli & Convenience is located at the easily reachable address of 240 Paterson Ave, East Rutherford, NJ 07073, USA. This prime location in East Rutherford places it conveniently for commuters, local employees, and residents throughout the borough and neighboring towns. Being on Paterson Avenue, the deli is central to the local community's daily routines. Its position offers straightforward access for a quick stop-in, a crucial factor for a business focused on speed and convenience.
The business is geared for a "Quick visit," meaning the layout and service model are optimized to get customers in and out efficiently, a true blessing for anyone on a tight schedule. Furthermore, the modern deli understands the need for flexible payment options, accepting both credit and debit cards, adding to the overall convenience for the local New Jersey clientele.
Services Offered
Legacy Deli & Convenience provides a robust range of services tailored for maximum customer convenience:
- Delivery Service: Meals can be ordered and delivered directly, catering to both residential and commercial areas nearby.
- In-store Pickup: Customers can place their orders ahead of time for fast collection at the counter.
- Takeout: Standard service for grabbing a meal to-go on the spot.
- In-store Shopping: Provides quick access to their full menu and convenience items.
- Daily Breakfast Service: A full menu of breakfast sandwiches and platters to start the morning right.
- Boar's Head Cold Cuts: Selling premium Boar's Head meats and cheeses by the pound for home use.
- Debit and Credit Card Payments: Accepts major card payments for a hassle-free transaction experience.
Features / Highlights
The menu at Legacy Deli & Convenience is notable for its quality ingredients and variety, making it a standout local deli:
- Premium Deli Meats: Features a dedicated selection of Boar's Head Cold Cuts, including Oven Roasted Turkey, Roast Beef, and Pastrami, ensuring high quality for both sandwiches and bulk purchases.
- The Legacy Platter: A signature menu item, offering a substantial and satisfying combination of protein, rice, and sides.
- Top-Rated Hot Sandwiches: Customers frequently highlight the excellence of the hot options, with the Philly Cheesesteak and Chopped Cheese being local favorites.
- All-Day Breakfast Options: A wide array of quick and classic morning meals, from a simple Butter Roll to a hearty Pastrami Egg & Cheese.
- Halal Platter Specialization: A strong and popular offering in the region, featuring items like the Lamb Gyro Platter, Chicken Platter, and the Mixed Gyro, all known for their reasonable price and good value.
- Combo Deals: Value-packed combo meals that pair a main dish, such as the Cheeseburger Deluxe or Buffalo Chicken Cheesesteak, with a side.
- Extensive Burger Menu: The burger selection goes beyond the basic cheeseburger, featuring unique options like the BBQ Bacon Cheeseburger and the morning-friendly Breakfast Burger.
Contact Information
For takeout, delivery, or general inquiries, customers in the New Jersey area can contact Legacy Deli & Convenience using the following details:
- Address: 240 Paterson Ave, East Rutherford, NJ 07073, USA
- Phone: (201) 571-4044
What is Worth Choosing
For first-time visitors or those looking for the deli’s specialties, the emphasis should be placed on the two distinct yet equally popular sides of their menu: the Halal offerings and the hot pressed sandwiches. The Halal Platters—especially the Mixed Platter—come highly recommended by local patrons for their robust flavor and excellent portion size, providing a full, satisfying meal.
In the sandwich category, the Philly Cheesesteak Combo is a consistent customer favorite, noted for its quality and quick preparation. For an all-in-one experience, try the Legacy Platter, which offers a complete meal experience with multiple proteins and sides.
For breakfast on the go, the deli provides one of the best selections around. While all the classics are available, the Bacon Egg & Cheese is a fundamental New Jersey staple that is executed perfectly here. Also, don't overlook the "Legacy Special" on the breakfast menu, which offers a great combination of flavor and value for a quick morning start. Lastly, knowing that they use Boar's Head meats, any sandwich made with their Oven Roasted Turkey or Italian cold cut combination is a guaranteed hit for lunch, providing the premium quality taste New Jersey deli enthusiasts expect.
Legacy Deli & Convenience Vibe
Breakfast
- Butter Roll $2.50
- Bagel with Cream Cheese $3.99
Plain bagel w/ cream cheese
- 2 Eggs $3.49
2 scrambled eggs served on a toasted roll or bagel w/ salt, pepper, & ketchup
- Egg & Cheese $3.99
2 scrambled eggs w/ American cheese served on a toasted roll or bagel w/ salt, pepper & ketchup
- Bacon Egg & Cheese $5.99
Turkey Bacon, 2 scrambled eggs, & American cheese served on a toasted roll or bagel w/ salt, pepper & ketchup
- Sausage Egg & Cheese $5.99
Turkey Sausage, 2 scrambled eggs & American cheese served on a toasted roll or bagel w/ salt, pepper & ketchup
- Pastrami Egg & Cheese $8.99
Boar's Head Pastrami, 2 scrambled eggs & American Cheese served on a toasted roll on bagel w/ salt, pepper & ketchup
- Ham Egg & Cheese $8.99
Boar's Head Ham, 2 scrambled eggs & American Cheese served on a toasted roll or bagel w/ salt, pepper & ketchup
- Mr. Muscle $7.99
Egg whites, Turkey, Green peppers, Onion & Tomato grilled w/ salt, pepper & ketchup served on a toasted roll
- Legacy Special $5.99
2 Scrambled Eggs w/ Onion, Green pepper & Tomato w/ salt, pepper, & ketchup
- B.L.T $7.99
Bacon, Lettuce & Tomato served on a toasted roll
Appetizers
- 6 ct. Wings $8.99
All wings served original, Buffalo or BBQ, with a side of Ranch dressing
- 12 ct, Wings $16.99
All wings served original, Buffalo or BBQ, with a side of Ranch dressing
- 12 ct. Wings w/ Fries $20.99
All wings served original, Buffalo or BBQ, with a side of Ranch dressing
- 3 ct. Tenders w/ Fries $11.99
3 Chicken Tenders served with French Fries with choice of honey mustard, ketchup, BBQ, or Ranch
- 5 ct. Tenders w/ Fries $13.99
3 Chicken Tenders served with French Fries with choice of honey mustard, ketchup, BBQ, or Ranch
- French Fries $4.99
Crispy French Fries tossed in Salt
Burgers
- Cheeseburger $10.99
100% Beef Patty w/ pickles, mayonnaise, lettuce, tomato & onion. Served with French fries
- BBQ Bacon Cheeseburger $12.99
100% Beef patty topped with BBQ sauce and bacon. Served with French Fries
- Breakfast Burger $13.99
100% Beef patty topped with scrambled egg, bacon & ketchup. Served with French Fries.
- Double Cheeseburger $13.99
Two, 100% Beef patty 100% w/ pickles, mayonnaise, lettuce, tomato & onion. Served with French fries
- Crispy Chicken $11.99
Crispy Chicken filet w/ pickles, mayonnaise, lettuce, tomato & onion. Served with French fries
- Grilled Chicken $11.99
Grilled Chicken filet w/ pickles, mayonnaise, lettuce, tomato & onion. Served with French fries
Halal Platters & Gyros
- Lamb Gyro Platter $12.99
Lamb Gyro served with rice, salad & delicious white sauce
- Chicken Platter $12.99
Chicken served with rice, salad & delicious white sauce
- Mixed Platter $13.99
Lamb Gyro & Chicken served with rice, salad & delicious white sauce
- Falafel Platter $10.99
Falafel served with rice, salad & delicious white sauce
- Legacy Platter $16.99
Mixed platter with fries, white sauce, chili sauce, & BBQ sauce
- Lamb Gyro $7.99
Gyro served on a warm pita with lettuce, tomato, onion & white sauce
- Chicken Gyro $6.99
Chicken served on a warm pita with lettuce, tomato, onion & white sauce
- Mixed Gyro $9.99
Gyro and chicken served on a warm pita with lettuce, tomato, onion & white sauce
Combos
- Philly Cheesesteak $14.99
w/ American Cheese, Onions & Peppers served on an Italian Hero. All combos come with French Fries and Canned Soda
- Chicken Cheesesteak $11.99
w/ American Cheese, Onions & Peppers served on a Italian Hero. All combos come with French Fries and Canned Soda
- Buffalo Chicken Cheesesteak $12.99
Buffalo Chicken Cheesesteak w/ onions, peppers & cheese. All combos come with French Fries and Canned Soda
- Chopped Cheese $15.99
Seasoned ground beef w/ onions, peppers, mayonnaise & ketchup served on a long roll with lettuce & tomato. All combos come with French Fries and Canned Soda
- Cheeseburger Deluxe $14.99
100% beef burger served on a toasted seeded bun w/ Pickles, lettuce, tomato, onion, mayonnaise & ketchup. All combos come with French Fries and Canned Soda
- Crispy Chicken Deluxe $14.99
Crispy chicken filet served on a toasted seeded bun w/pickles, lettuce, tomato, onions, mayonnaise. All combos come with French Fries and Canned Soda
- 5 ct. Chicken Tender $13.99
5 piece chicken tenders served with fries and choice of sauce
Boars Head Cold Cuts
- Oven Roasted Turkey $13.99
All deli sandwiches served on an italian hero w/Lettuce, tomato, onion, american cheese, oil & Vinegar served with french fries
- Honey Turkey $13.99
All deli sandwiches served on an italian hero w/Lettuce, tomato, onion, american cheese, oil & Vinegar served with french fries
- Ham $13.99
All deli sandwiches served on an italian hero w/Lettuce, tomato, onion, american cheese, oil & Vinegar served with french fries
- Chipotle Chicken $13.99
All deli sandwiches served on an italian hero w/Lettuce, tomato, onion, american cheese, oil & Vinegar served with french fries
- Genoa Salami $13.99
All deli sandwiches served on an italian hero w/Lettuce, tomato, onion, american cheese, oil & Vinegar served with french fries
- Roast Beef $14.99
All deli sandwiches served on an italian hero w/Lettuce, tomato, onion, american cheese, oil & Vinegar served with french fries
- Pastrami $14.49
All deli sandwiches served on an italian hero w/Lettuce, tomato, onion, american cheese, oil & Vinegar served with french fries
- Italian $15.99
Ham, Turkey & Salami served on an italian hero w/Lettuce, tomato, onion, provolone cheese, oil & Vinegar served with french fries
Boar's Head Round Roll
- Oven Roasted Turkey $7.99
Served on a round roll w/Lettuce, tomato, onion, american cheese, oil & Vinegar
- Honey Turkey $7.99
Served on a round roll w/Lettuce, tomato, onion, american cheese, oil & Vinegar
- Ham $7.99
Served on a round roll w/Lettuce, tomato, onion, american cheese, oil & Vinegar
- Chipotle Chicken $7.99
Served on a round roll w/Lettuce, tomato, onion, american cheese, oil & Vinegar
- Genoa Salami $7.99
Served on a round roll w/Lettuce, tomato, onion, american cheese, oil & Vinegar
- Roast Beef $8.49
Served on a round roll w/Lettuce, tomato, onion, american cheese, oil & Vinegar
- Pastrami $8.49
Served on a round roll w/Lettuce, tomato, onion, american cheese, oil & Vinegar
Boar's Head Per Pound
- Any Deli Meat $15.99
15.99 per lb
- Turkey Bacon $15.99
15.99 per lb
- Turkey Sausage $15.99
15.99 per pound
- American Cheese $10.49
10.49 per lb
- Swiss Cheese $10.79
10.79 per lb
- Provolone Cheese $10.79
10.79 per lb
Legacy Deli & Convenience Details
Service options
- Delivery
- In-store pickup
- In-store shopping
- Takeout
Planning
- Quick visit
Payments
- Credit cards
- Debit cards
- Credit cards
Legacy Deli & Convenience Photos










Legacy Deli & Convenience Location
Legacy Deli & Convenience
240 Paterson Ave, East Rutherford, NJ 07073, USA
Legacy Deli & Convenience Reviews
shawarmacheesesteakwrapchickengyroplatterkids
★ 5★ 4★ 3★ 2★ 1Their halal platters and philly cheese steak are pretty good, they're the favorite things I've had here so far. It usually doesn't take more than 15 minutes for the food to be ready. Prices and value are also very reasonable for the area.
July 05 · Anthony LeeI ordered a roast beef sandwich and if they put two pieces of meat on the roll it was a lot. Was more like a salad out of a piece of bread. Definitely not worth the money
September 23 · Robert BradfordFood is the best in town, no one can compete. The handsome young man with the lucious hair and beard was nice to me and my little daughter, offered her some candy and shows her so much love. Ahmad is a great guy, this store deserves to have 5 rating. Their gyro and shawarma are the best, can’t go to anyone else. Love the way he chops the cheese. If you ask him for the Azhar special, he will give you the best Bengali Mongsho Kebab, definitely recommend.
March 31 · Getting LuckI love the place but items are overpriced and I don’t like how when I buy something like recess and on the screen it shows as custom entry as if they are overcharging me for it
June 25 · BashirWe were just passing by and found this place, we were hungry and stopped for a Turkey sandwich, the sandwich was really good and forgot to take a picture of it! That was my first time here, will come back again definitely for another sandwich:) he took a note of what I asked him for my sandwich and he didn’t miss any, I really like lefty people ;)
August 12 · Yashar Partovi
More restaurants near me
Food Baby5.0 (1 reviews)240 Paterson Ave, East Rutherford, NJ 07073, USA
Chef Chan Restaurant4.0 (235 reviews)238 Paterson Ave, East Rutherford, NJ 07073, USA
Herbalife MLM Magic Vibes Nutrition4.0 (9 reviews)138 Park Ave, East Rutherford, NJ 07073, USA
Panera Bread3.0 (997 reviews)95 NJ-17, East Rutherford, NJ 07073, USA
Red Kettle Coffee House4.0 (321 reviews)38 Enoch St, East Rutherford, NJ 07073, USA
Dominick's Restaurant & Bar - Al Di La Caterers4.0 (562 reviews)1 Hoboken Rd, East Rutherford, NJ 07073, USA
Mamoun's Falafel4.0 (508 reviews)84 NJ-17, East Rutherford, NJ 07073, USA
Starbucks4.0 (707 reviews)10 NJ-17, East Rutherford, NJ 07073, USA
Buffalo's4.0 (509 reviews)261 Hackensack St, Wood-Ridge, NJ 07075, USA
Rola's Kitchen Mediterranean Grill4.0 (529 reviews)259 Valley Blvd, Wood-Ridge, NJ 07075, USA
Lovin' Today4.0 (213 reviews)257 Valley Blvd, Wood-Ridge, NJ 07075, USA
Nick & Mattu2019s Blue Cafe4.0 (70 reviews)273 Valley Blvd, Wood-Ridge, NJ 07075, USA
Categories
Top Visited Sites
Tornado Crepes5.0 (7 reviews)
McDonald's3.0 (2741 reviews)
World Health Juice Bar And Deli.4.0 (129 reviews)
Jumbo Italian Ice4.0 (95 reviews)
Alta4.0 (802 reviews)
Rajni Indian cuisine4.0 (1184 reviews)Top restaurants Searches
Trending Dining Insights Posts
How Wine Bars Are Becoming Popular Nighttime Destinations
How Ice Cream Shops Are Creating Interactive Customer Experiences
Discovering Donut Shops That Combine Nostalgic and Contemporary Flavors
How Asian Restaurants Are Adapting Traditional Recipes for Modern Palates
Best Spaghetti with Meatballs Near Me: Where to Find the Best Italian Dish
How American Restaurants Are Reinventing Classic Burgers With Unique Flavors
