Dine Droop
Dine DroopDining Insightsrestaurants near me
ConnecticutNew JerseyNew York

Dine Drooprestaurants near meNew JerseyBergen CountyTeaneckrestaurants in Queen Anne RoadSchnitzel +
Schnitzel + ico

Schnitzel +
- 1450 Queen Anne Rd, Teaneck, NJ 07666

Kosher restaurant, Fast food restaurant ★4.0 (43)·$20–30

1450 Queen Anne Rd, Teaneck, NJ 07666, USA

4.0
The food here is simply amazing. Finding a restaurant this clean is rare and you can tell the kitchen and front staff are meticulous about their cleanliness. The whole restaurant was spotless. The staff were so friendly and eager to answer any questions. I will definitely be coming back. - Emmanuel Abanes
Schnitzel + Overview Intro Vibe Detail Photos Location Reviews
$20–30 per person Reported by 43 people$10–20$20–30$30–50

Schnitzel + Introduce

For New Jersey residents, especially those in Bergen County and the Teaneck area, the search for quick, high-quality, and satisfying fast food that adheres to Kosher standards often leads to one exceptional place: **Schnitzel +**. Located right on Queen Anne Road, this restaurant has established itself as a must-visit destination for an array of delicious, comforting meals. It’s more than just a quick bite; it's a specialty destination that brings a unique, flavorful twist to the fast food concept.

**Schnitzel +** expertly combines the speed and convenience of a **fast food restaurant** with a deep menu of specialty items, ensuring there’s something for everyone. While the name suggests a focus on the crispy, classic schnitzel, the menu extends to fantastic burgers, Israeli specialties like Shawarma and Falafel, and fresh salads. The atmosphere is described as **casual and trendy**, attracting a wide crowd from **college students** to **groups** and **locals**. Furthermore, the commitment to cleanliness and friendly service, as highlighted by multiple customer reviews, truly sets this local spot apart, making it a reliable and enjoyable choice for **lunch, dinner, and even late-night food**.


Location and Accessibility

Accessibility is key in North Jersey, and **Schnitzel +** offers exceptional convenience for its patrons. The restaurant is perfectly situated at **1450 Queen Anne Rd, Teaneck, NJ 07666, USA**. This central Teaneck location makes it an easy drive or quick stop for anyone in the area.

For drivers, the ease of access is boosted by the availability of a **free parking lot** as well as **free street parking**, eliminating the hassle of searching for a spot. Critically, Schnitzel + is dedicated to being welcoming to all members of the community, offering a comprehensive set of **accessibility** features. These include a **wheelchair accessible entrance**, **wheelchair accessible parking lot**, **wheelchair accessible restroom**, and **wheelchair accessible seating**, ensuring a comfortable experience for every guest.


Services Offered

Schnitzel + provides a full range of services designed to fit the busy schedules and diverse needs of New Jersey residents. Whether you want to dine in, take your meal to go, or have a large event catered, they have a convenient option for you.

  • **Dine-in Service:** Enjoy your meal in the **casual and trendy** environment with comfortable **seating** options. It’s a great spot for a quick break or a leisurely meal with friends.
  • **Delivery and Takeout:** For maximum convenience, the restaurant offers both **Delivery** and **Takeout** services, making it easy to enjoy their signature schnitzel and burgers from the comfort of your home or office.
  • **Lunch and Dinner:** The establishment is immensely **popular for lunch and dinner**, catering to solo diners, groups, and families throughout the day.
  • **Catering:** Planning an office event, family gathering, or a large party? Schnitzel + offers extensive **Catering** options, including half and full trays of their delicious salads (like Healthy Salad and Sabich Salad) and presumably, their main meat platters.
  • **Special Lunch Hours:** Take advantage of the dedicated **Lunch Special (11 am to 2:30 pm)** menu, which features great deals on favorites like the **Lunch Special Shawarma Pita**, **Falafel Pita**, and **Burger**.
  • **Payments:** All major payment methods are accepted, including **Credit cards, Debit cards, and NFC mobile payments**, for a quick and easy transaction.

Features / Highlights of the Menu

The menu at Schnitzel + is a testament to flavorful, high-quality, and comforting Kosher fast food. The "plus" in the name truly reflects the variety offered beyond their namesake dish.

  • **The Schnitzel Selection:** The star is, of course, the schnitzel. Choose from specialty chicken sandwiches like the **Classic Sandwich**, the spicy **Mexican Sandwich**, or the unique **Pretzel Sandwich**. The **Classic Schnitzel Platter** ($29.99) is perfect for a hearty meal with sides. They also offer a decadent **Challa Yumyum Schnitzel Sandwich** ($17.99).
  • **Signature Chicken Fingers:** Beyond the sandwich, their **Chicken Fingers** are a highlight, available in large quantities (up to 48 pieces for $84.95) for groups or parties, and also in the specialized **Pretzel Fingers** version.
  • **Juicy Burgers and Classic Israeli Items:** The menu features great burger options like the **Jersey Burger** and the **Egg & Onion Burger**. For traditional Israeli fare, enjoy a perfect **Shawarma Sandwich** or **Falafel Pita**, or an authentic **Sabich Pita** ($12.95), which contains fried eggplant and hard-boiled egg.
  • **Late-Night and Comfort Offerings:** As a great source of **late-night food**, it caters to night owls and students. Classic **Comfort food** options also include **Homemade Soup** (Chicken or Lentil, up to 32 oz for $15.99), perfect for a chilly New Jersey evening.
  • **Kid-Friendly Options:** Families love the dedicated **Kids Menu**, which includes easy favorites like the **Hot Dog Kids Meal** and **Chicken Fingers Kids Meal** (all $14.99). They also provide **High chairs**.
  • **Customization and Sides:** Patrons can fully customize their meals with a vast selection of homemade sauces and dressings, including **Schug**, **Amba**, **Spicy Mayo**, and **Garlic Mayo** ($0.95 each). Sides range from **Garlic Fries** ($7.99) and **Sweet Potato Fries** ($8.99) to **Hummus**, **Israeli Salad**, and **Corn Salsa** (all $8.99).

Contact Information

To experience the unique and satisfying Kosher fast food at Schnitzel +, here is the essential contact information.

**Address:** 1450 Queen Anne Rd, Teaneck, NJ 07666, USA

**Phone:** (201) 833-2301

**Mobile Phone:** +1 201-833-2301


What is Worth Choosing at Schnitzel +

For locals in the New Jersey area, **Schnitzel +** is worth choosing for several compelling reasons that go beyond the typical fast-food experience. The most significant factor is its dual specialty: providing **high-quality, flavorful fast food** that is also strictly **Kosher**. This fills a vital need in the community, offering convenience without compromising on dietary requirements or taste.

The sheer **breadth of the menu** is a major draw. You can satisfy a craving for a traditional American burger or chicken fingers, or you can opt for authentic Israeli specialties like **Sabich** and **Shawarma**. The quality is consistently high, with customers praising the restaurant’s meticulous **cleanliness** and the **taste and quality** of the food, even simple items like the chicken fingers, which are noted for their generous portions. The daily **Lunch Specials** offer incredible value, providing a full, satisfying meal at a great price point during the workday. Finally, the welcoming staff and excellent **accessibility** features make it a comfortable, stress-free dining destination for every member of the family or group. Schnitzel + is not just a place to grab a quick meal; it's a reliable, delicious, and community-focused establishment in Teaneck that truly serves a local specialty.

Schnitzel + Vibe

  • *LUNCH SPECIAL(11am 2:30pm) - Lunch Special (11 am to 2:30pm)

  • Lunch Special Falafel Pita
  • Lunch Special Shawarma Pita
  • Lunch Special Pita Sandwich
  • Lunch Special Sabich Pita
  • Lunch Special 6 Chicken Fingers
  • Lunch Special Burger
  • Lunch Special (11 am to 2:30pm)

  • Lunch Special Falafel Pita
  • Lunch Special Shawarma Pita
  • Lunch Special Pita Sandwich
  • Lunch Special Sabich Pita
  • Lunch Special 6 Chicken Fingers
  • Lunch Special Burger
  • FOOD - Chicken Sandwiches Fried/Grilled

  • Classic Sandwich

    lettuce, tomato, mayo

  • Mexican Sandwich

    corn salsa, avocado, spicy mayo

  • Israeli Sandwich

    israeli salad, pickles, hummus, tahini

  • Pretzel Sandwich

    sauteed onion, tomato, honey mustard

  • BBQ Sandwich

    coleslaw, pickles, bbq sauce

  • BYO Sandwich
  • Shawarma Sandwich

    Israeli salad, Pickles, Hummus, Tahini

  • Falafel Pita

    Israeli salad, Pickles, Hummus, Tahini

  • Sabich Pita $12.95

    Hummus,Israeli salad,hard Boil Egg,Thahini ,Amba

  • Challa Yumyum Schnitzel Sandwich $17.99

    Challa bun,Moroccan tomato matbucha,Fried eggplant,Thaini.

  • FOOD - Chicken Fingers

  • 6 Chicken Fingers $14.95
  • 12 Chicken Fingers $27.95
  • 24 Chicken Fingers $49.95
  • 48 Chicken Fingers $84.95
  • 6 Pretzel Fingers $15.95
  • 12 Pretzel Fingers $29.95
  • 24 Pretzel Fingers $51.95
  • 48 Pretzel Fingers $87.95
  • FOOD - Burgers

  • Original Burger

    lettuce, Tomato, Red onion, Pickles, Special sauce

  • Egg & Onion Burger

    Fried egg, Tomato, Sauteed onion, Special sauce

  • Jersey Burger

    Sauteed mushroom, Sauteed onion ,Tomato, Special sauce

  • BBQ Burger

    Coleslaw, Pickles, Bbq sauce

  • Slider Burger $5.99

    tomato & pickles

  • California Burger

    Avocado, Tomato, Egg, Special sauce

  • FOOD - Fries & Sides

  • French Fries $6.99
  • Garlic Fries $7.99
  • Sweet Potato Fries $8.99
  • Onion Rings $8.99
  • 4 Falafel Balls $3.99

    small tahini on side

  • Coleslaw 12 Oz $8.99
  • Corn Salsa 12 Oz $8.99
  • Hummus 12 Oz $8.99
  • Israeli Salad 12oz $8.99
  • Pickles 12oz $5.00
  • Half Sliced Avocado $4.95
  • Smash Avocado 12 Oz $8.25
  • Sauteed Onion 12 Oz $5.00
  • Tahini 12 Oz $6.50
  • Hot Dog In Bun $6.99
  • Crunchy Hot Dog $6.25
  • Rice 12oz $6.99
  • Hard Boiled Egg $1.50
  • FOOD - Salads

  • Mexican Salad $14.99

    iceberg lettuce, corn salsa ,avocado, red onion

  • Healthy Salad $14.99

    Iceberg lettuce ,Shredded carrots. Corn, Cucumber, Tomato.

  • Portobello Salad $14.99

    Iceberg lettuce, Tomato, Eggplant, Roasted red pepper, Corn

  • Sabich Salad $14.99

    Iceberg lettuce, Tomato, Cucumber,Eggplant,Pickles,Hard boiled eggs

  • Quinoa Salad $14.99

    Iceberg lettuce, Beets,Cucumber, Chickpeas,Dry cranberries

  • BYO Salad $14.99
  • FOOD - Platters

  • Half Platter W/One Side $21.99
  • Grilled Chicken Platter $29.99
  • Classic Schnitzel Platter $29.99
  • Pretzel Schnitzel Platter $29.99
  • Shawarma Platter $29.99
  • FOOD - Homemade Soup

  • 12oz Chicken Soup $7.99
  • 16oz Chicken Soup $8.99
  • 16oz Lentil Soup $8.99
  • 12oz Lentil Soup $6.99
  • Xlg Lentil Soup 32 Oz (To Go Only) $14.99
  • Xlg Chicken Soup 32 Oz (To Go Only) $15.99
  • FOOD - Kids Menu

  • Hot Dog Kids Meal $14.99
  • Chicken Fingers Kids Meal (3 Pc) $14.99
  • Pretzel Fingers Kids Meal(3pc) $14.99
  • Sliders Kids Meal(2) $14.99
  • FOOD - Meats

  • 1 Piece Schnitzel $10.00
  • 1 Piece Grilled Chicken $7.95
  • 1 Piece Pretzel $11.00
  • One Burger Patty $9.00
  • 1 Shawarma Half Portion $12.00
  • FOOD - Breads

  • Pita $1.75
  • 6" Baguette $2.50
  • 12" Baguette $4.95
  • 24" Baguette $7.95
  • Laffa $4.75
  • Whole Wheat Wrap $1.99
  • Hot Dog Bun $1.50
  • Gluten Free Bun $3.50
  • Burger Bun $2.50
  • FOOD - Sweets

  • Lg Chocolate Chip Cookies $4.95
  • Smores Chocolate Chips Cookies $4.95
  • 3 Sm Chocolate Chips Cookies $3.75
  • FOOD - Dressings

  • 3 Oz Balsamic Vinagrette $0.95
  • 3 Oz Garlic Mayo $0.95
  • 3 Oz Spicy Mayo $0.95
  • 3 Oz Special Sauce $0.95
  • 3 Oz Lemon Olive Oil $0.95
  • 3 Oz BBQ $0.95
  • 3 Oz Tahini $0.95
  • 3 Oz Honey Mustard $0.95
  • 3 Oz Sweet Chilli $0.95
  • 3 Oz Buffalo $0.95
  • Schug $0.95
  • 3 Oz Amba $0.95
  • Ketchup $0.00
  • Mustard $0.00
  • 12 Oz Sauce $6.00
  • 16 Oz Sauce $9.00
  • FOOD - Make it a Meal

  • Make It A Meal Reg Fries
  • Make It A Meal Sm Garlic Fries
  • Chicken Sandwiches Fried/Grilled

  • Classic Sandwich

    lettuce, tomato, mayo

  • Mexican Sandwich

    corn salsa, avocado, spicy mayo

  • Israeli Sandwich

    israeli salad, pickles, hummus, tahini

  • Pretzel Sandwich

    sauteed onion, tomato, honey mustard

  • BBQ Sandwich

    coleslaw, pickles, bbq sauce

  • BYO Sandwich
  • Shawarma Sandwich

    Israeli salad, Pickles, Hummus, Tahini

  • Falafel Pita

    Israeli salad, Pickles, Hummus, Tahini

  • Sabich Pita $12.95

    Hummus,Israeli salad,hard Boil Egg,Thahini ,Amba

  • Challa Yumyum Schnitzel Sandwich $17.99

    Challa bun,Moroccan tomato matbucha,Fried eggplant,Thaini.

  • Chicken Fingers

  • 6 Chicken Fingers $14.95
  • 12 Chicken Fingers $27.95
  • 24 Chicken Fingers $49.95
  • 48 Chicken Fingers $84.95
  • 6 Pretzel Fingers $15.95
  • 12 Pretzel Fingers $29.95
  • 24 Pretzel Fingers $51.95
  • 48 Pretzel Fingers $87.95
  • Burgers

  • Original Burger

    lettuce, Tomato, Red onion, Pickles, Special sauce

  • Egg & Onion Burger

    Fried egg, Tomato, Sauteed onion, Special sauce

  • Jersey Burger

    Sauteed mushroom, Sauteed onion ,Tomato, Special sauce

  • BBQ Burger

    Coleslaw, Pickles, Bbq sauce

  • Slider Burger $5.99

    tomato & pickles

  • California Burger

    Avocado, Tomato, Egg, Special sauce

  • Fries & Sides

  • French Fries $6.99
  • Garlic Fries $7.99
  • Sweet Potato Fries $8.99
  • Onion Rings $8.99
  • 4 Falafel Balls $3.99

    small tahini on side

  • Coleslaw 12 Oz $8.99
  • Corn Salsa 12 Oz $8.99
  • Hummus 12 Oz $8.99
  • Israeli Salad 12oz $8.99
  • Pickles 12oz $5.00
  • Half Sliced Avocado $4.95
  • Smash Avocado 12 Oz $8.25
  • Sauteed Onion 12 Oz $5.00
  • Tahini 12 Oz $6.50
  • Hot Dog In Bun $6.99
  • Crunchy Hot Dog $6.25
  • Rice 12oz $6.99
  • Hard Boiled Egg $1.50
  • Salads

  • Mexican Salad $14.99

    iceberg lettuce, corn salsa ,avocado, red onion

  • Healthy Salad $14.99

    Iceberg lettuce ,Shredded carrots. Corn, Cucumber, Tomato.

  • Portobello Salad $14.99

    Iceberg lettuce, Tomato, Eggplant, Roasted red pepper, Corn

  • Sabich Salad $14.99

    Iceberg lettuce, Tomato, Cucumber,Eggplant,Pickles,Hard boiled eggs

  • Quinoa Salad $14.99

    Iceberg lettuce, Beets,Cucumber, Chickpeas,Dry cranberries

  • BYO Salad $14.99
  • Platters

  • Half Platter W/One Side $21.99
  • Grilled Chicken Platter $29.99
  • Classic Schnitzel Platter $29.99
  • Pretzel Schnitzel Platter $29.99
  • Shawarma Platter $29.99
  • Homemade Soup

  • 12oz Chicken Soup $7.99
  • 16oz Chicken Soup $8.99
  • 16oz Lentil Soup $8.99
  • 12oz Lentil Soup $6.99
  • Xlg Lentil Soup 32 Oz (To Go Only) $14.99
  • Xlg Chicken Soup 32 Oz (To Go Only) $15.99
  • Kids Menu

  • Hot Dog Kids Meal $14.99
  • Chicken Fingers Kids Meal (3 Pc) $14.99
  • Pretzel Fingers Kids Meal(3pc) $14.99
  • Sliders Kids Meal(2) $14.99
  • Meats

  • 1 Piece Schnitzel $10.00
  • 1 Piece Grilled Chicken $7.95
  • 1 Piece Pretzel $11.00
  • One Burger Patty $9.00
  • 1 Shawarma Half Portion $12.00
  • Breads

  • Pita $1.75
  • 6" Baguette $2.50
  • 12" Baguette $4.95
  • 24" Baguette $7.95
  • Laffa $4.75
  • Whole Wheat Wrap $1.99
  • Hot Dog Bun $1.50
  • Gluten Free Bun $3.50
  • Burger Bun $2.50
  • Sweets

  • Lg Chocolate Chip Cookies $4.95
  • Smores Chocolate Chips Cookies $4.95
  • 3 Sm Chocolate Chips Cookies $3.75
  • Dressings

  • 3 Oz Balsamic Vinagrette $0.95
  • 3 Oz Garlic Mayo $0.95
  • 3 Oz Spicy Mayo $0.95
  • 3 Oz Special Sauce $0.95
  • 3 Oz Lemon Olive Oil $0.95
  • 3 Oz BBQ $0.95
  • 3 Oz Tahini $0.95
  • 3 Oz Honey Mustard $0.95
  • 3 Oz Sweet Chilli $0.95
  • 3 Oz Buffalo $0.95
  • Schug $0.95
  • 3 Oz Amba $0.95
  • Ketchup $0.00
  • Mustard $0.00
  • 12 Oz Sauce $6.00
  • 16 Oz Sauce $9.00
  • Make it a Meal

  • Make It A Meal Reg Fries
  • Make It A Meal Sm Garlic Fries
  • DRINKS - Soft drink

  • Coke $2.50
  • Sprite $2.50
  • Coke Zero $2.50
  • Water $1.75
  • Diet Coke $2.50
  • Ginger Ale $2.50
  • Selzter Water $2.50
  • Juice Box $1.75
  • Zero Sugar Peach Snapple $3.50
  • Peach Snapple $3.50
  • Raspberry Snapple $3.50
  • Sugar Free Rasberry Snapple $3.50
  • Strawberry Kiwi Snapple $3.50
  • Gatorade Fruit Punch $3.50
  • Gatorade Lemon Lime $3.50
  • Gatorade Cool Blue $3.50
  • Soft drink

  • Coke $2.50
  • Sprite $2.50
  • Coke Zero $2.50
  • Water $1.75
  • Diet Coke $2.50
  • Ginger Ale $2.50
  • Selzter Water $2.50
  • Juice Box $1.75
  • Zero Sugar Peach Snapple $3.50
  • Peach Snapple $3.50
  • Raspberry Snapple $3.50
  • Sugar Free Rasberry Snapple $3.50
  • Strawberry Kiwi Snapple $3.50
  • Gatorade Fruit Punch $3.50
  • Gatorade Lemon Lime $3.50
  • Gatorade Cool Blue $3.50
  • Catering - Salads (half tray)9 by 13

  • Healthy Salad (Half Tray)9 By 13 $65.00

    Iceberg lettuce ,Shredded carrots. Corn, Cucumber, Tomato.

  • Sabich Salad
  • Mexican Salad
  • Portabello Salad
  • Quinoa Salad
  • Israeli Salad
  • Healthy Salad ( Full Tray) $120.00
  • Catering - Protein meat (half or full tray)

  • Chicken Fingers
  • Pretzel Chicken Fingers
  • Grilled Chicken
  • Schnitzel
  • Pretzel Schnitzel
  • Shawarma
  • Catering - Fries

  • French Fries
  • Sweet Potato Fries
  • Garlic Fries
  • Onion Rings
  • Catering - Sandwiches Platters

  • Sm. Sandwich Platter (Up To 12 Ppl) $180.00
  • Lg. Sandwich Platter (Up To 16 Ppl) $210.00
  • Catering - Sides

  • Corn Salsa
  • Cole Slaw
  • Hummus
  • Tahini
  • Rice
  • Catering - Cookies Platters

  • Small Platter (10 Lg Cookies) $40.00
  • Large Platter (25 Lg Cookies) $95.00
  • Salads (half tray)9 by 13

  • Healthy Salad (Half Tray)9 By 13 $65.00

    Iceberg lettuce ,Shredded carrots. Corn, Cucumber, Tomato.

  • Sabich Salad
  • Mexican Salad
  • Portabello Salad
  • Quinoa Salad
  • Israeli Salad
  • Healthy Salad ( Full Tray) $120.00
  • Protein meat (half or full tray)

  • Chicken Fingers
  • Pretzel Chicken Fingers
  • Grilled Chicken
  • Schnitzel
  • Pretzel Schnitzel
  • Shawarma
  • Fries

  • French Fries
  • Sweet Potato Fries
  • Garlic Fries
  • Onion Rings
  • Sandwiches Platters

  • Sm. Sandwich Platter (Up To 12 Ppl) $180.00
  • Lg. Sandwich Platter (Up To 16 Ppl) $210.00
  • Sides

  • Corn Salsa
  • Cole Slaw
  • Hummus
  • Tahini
  • Rice
  • Cookies Platters

  • Small Platter (10 Lg Cookies) $40.00
  • Large Platter (25 Lg Cookies) $95.00

Schnitzel + Details

  • Service options

  • Delivery
  • Takeout
  • Dine-in
  • Highlights

  • Serves local specialty
  • Popular for

  • Lunch
  • Dinner
  • Solo dining
  • Accessibility

  • Wheelchair accessible entrance
  • Wheelchair accessible parking lot
  • Wheelchair accessible restroom
  • Wheelchair accessible seating
  • Offerings

  • Comfort food
  • Late-night food
  • Quick bite
  • Small plates
  • Dining options

  • Lunch
  • Dinner
  • Catering
  • Dessert
  • Seating
  • Table service
  • Amenities

  • Restroom
  • Atmosphere

  • Casual
  • Trendy
  • Crowd

  • College students
  • Groups
  • Tourists
  • Planning

  • Accepts reservations
  • Payments

  • Credit cards
  • Debit cards
  • NFC mobile payments
  • Credit cards
  • Children

  • Good for kids
  • High chairs
  • Kids' menu
  • Parking

  • Free parking lot
  • Free street parking
  • Parking

Schnitzel + Photos

Schnitzel + Picture 1Schnitzel + Picture 2Schnitzel + Picture 3Schnitzel + Picture 4Schnitzel + Picture 5Schnitzel + Picture 6Schnitzel + Picture 7Schnitzel + Picture 8Schnitzel + Picture 9Schnitzel + Picture 10

Schnitzel + Location

Schnitzel +

1450 Queen Anne Rd, Teaneck, NJ 07666, USA

Schnitzel + Reviews

An average rating of ★4.4 from 561 user reviews.

burgerchicken fingersfast foodshawarmakidsfalafelsidespaypitato go

★ 5★ 4★ 3★ 2★ 1

More restaurants near me

  • Rock N' Roll Sushi & Noodle BarRock N' Roll Sushi & Noodle Bar4.0 (470 reviews)

    1448A Queen Anne Rd, Teaneck, NJ 07666, USA

  • Jus by Julie TeaneckJus by Julie Teaneck4.0 (52 reviews)

    1454 Queen Anne Rd, Teaneck, NJ 07666, USA

  • EJ's PlaceEJ's Place4.0 (314 reviews)

    1448 Queen Anne Rd, Teaneck, NJ 07666, USA

  • CarvelCarvel4.0 (46 reviews)

    1389 Queen Anne Rd, Teaneck, NJ 07666, USA

  • The BrickeryThe Brickery5.0 (44 reviews)

    195 Englewood Ave, Teaneck, NJ 07666, USA

  • Chopstix Kosher ChineseChopstix Kosher Chinese4.0 (192 reviews)

    172 W Englewood Ave A, Teaneck, NJ 07666, USA

  • Mrs Fields Cookies Northern NJMrs Fields Cookies Northern NJ2.0 (3 reviews)

    Inside Poppy's Bagels, 204 W Englewood Ave, Teaneck, NJ 07666, USA

  • Sweet T's Southern Eatery Restaurant and BarSweet T's Southern Eatery Restaurant and Bar4.0 (341 reviews)

    166 W Englewood Ave, Teaneck, NJ 07666, USA

  • Los 3 Amigos RestaurantLos 3 Amigos Restaurant4.0 (46 reviews)

    1356 A Queen Anne Rd, Teaneck, NJ 07666, USA

  • WORLD OF GOODIESWORLD OF GOODIES4.0 (74 reviews)

    198 W Englewood Ave, Teaneck, NJ 07666, USA

  • Poppy's Bagels Pizza and TCBYPoppy's Bagels Pizza and TCBY4.0 (360 reviews)

    204 W Englewood Ave, Teaneck, NJ 07666, USA

  • Seoul BiteSeoul Bite4.0 (52 reviews)

    206 W Englewood Ave, Teaneck, NJ 07666, USA

  • Categories

    Top Visited Sites

    Top restaurants Searches

    Trending Dining Insights Posts