Schnitzel + Introduce
For New Jersey residents, especially those in Bergen County and the Teaneck area, the search for quick, high-quality, and satisfying fast food that adheres to Kosher standards often leads to one exceptional place: **Schnitzel +**. Located right on Queen Anne Road, this restaurant has established itself as a must-visit destination for an array of delicious, comforting meals. It’s more than just a quick bite; it's a specialty destination that brings a unique, flavorful twist to the fast food concept.
**Schnitzel +** expertly combines the speed and convenience of a **fast food restaurant** with a deep menu of specialty items, ensuring there’s something for everyone. While the name suggests a focus on the crispy, classic schnitzel, the menu extends to fantastic burgers, Israeli specialties like Shawarma and Falafel, and fresh salads. The atmosphere is described as **casual and trendy**, attracting a wide crowd from **college students** to **groups** and **locals**. Furthermore, the commitment to cleanliness and friendly service, as highlighted by multiple customer reviews, truly sets this local spot apart, making it a reliable and enjoyable choice for **lunch, dinner, and even late-night food**.
Accessibility is key in North Jersey, and **Schnitzel +** offers exceptional convenience for its patrons. The restaurant is perfectly situated at **1450 Queen Anne Rd, Teaneck, NJ 07666, USA**. This central Teaneck location makes it an easy drive or quick stop for anyone in the area.
For drivers, the ease of access is boosted by the availability of a **free parking lot** as well as **free street parking**, eliminating the hassle of searching for a spot. Critically, Schnitzel + is dedicated to being welcoming to all members of the community, offering a comprehensive set of **accessibility** features. These include a **wheelchair accessible entrance**, **wheelchair accessible parking lot**, **wheelchair accessible restroom**, and **wheelchair accessible seating**, ensuring a comfortable experience for every guest.
Schnitzel + provides a full range of services designed to fit the busy schedules and diverse needs of New Jersey residents. Whether you want to dine in, take your meal to go, or have a large event catered, they have a convenient option for you.
- **Dine-in Service:** Enjoy your meal in the **casual and trendy** environment with comfortable **seating** options. It’s a great spot for a quick break or a leisurely meal with friends.
- **Delivery and Takeout:** For maximum convenience, the restaurant offers both **Delivery** and **Takeout** services, making it easy to enjoy their signature schnitzel and burgers from the comfort of your home or office.
- **Lunch and Dinner:** The establishment is immensely **popular for lunch and dinner**, catering to solo diners, groups, and families throughout the day.
- **Catering:** Planning an office event, family gathering, or a large party? Schnitzel + offers extensive **Catering** options, including half and full trays of their delicious salads (like Healthy Salad and Sabich Salad) and presumably, their main meat platters.
- **Special Lunch Hours:** Take advantage of the dedicated **Lunch Special (11 am to 2:30 pm)** menu, which features great deals on favorites like the **Lunch Special Shawarma Pita**, **Falafel Pita**, and **Burger**.
- **Payments:** All major payment methods are accepted, including **Credit cards, Debit cards, and NFC mobile payments**, for a quick and easy transaction.
The menu at Schnitzel + is a testament to flavorful, high-quality, and comforting Kosher fast food. The "plus" in the name truly reflects the variety offered beyond their namesake dish.
- **The Schnitzel Selection:** The star is, of course, the schnitzel. Choose from specialty chicken sandwiches like the **Classic Sandwich**, the spicy **Mexican Sandwich**, or the unique **Pretzel Sandwich**. The **Classic Schnitzel Platter** ($29.99) is perfect for a hearty meal with sides. They also offer a decadent **Challa Yumyum Schnitzel Sandwich** ($17.99).
- **Signature Chicken Fingers:** Beyond the sandwich, their **Chicken Fingers** are a highlight, available in large quantities (up to 48 pieces for $84.95) for groups or parties, and also in the specialized **Pretzel Fingers** version.
- **Juicy Burgers and Classic Israeli Items:** The menu features great burger options like the **Jersey Burger** and the **Egg & Onion Burger**. For traditional Israeli fare, enjoy a perfect **Shawarma Sandwich** or **Falafel Pita**, or an authentic **Sabich Pita** ($12.95), which contains fried eggplant and hard-boiled egg.
- **Late-Night and Comfort Offerings:** As a great source of **late-night food**, it caters to night owls and students. Classic **Comfort food** options also include **Homemade Soup** (Chicken or Lentil, up to 32 oz for $15.99), perfect for a chilly New Jersey evening.
- **Kid-Friendly Options:** Families love the dedicated **Kids Menu**, which includes easy favorites like the **Hot Dog Kids Meal** and **Chicken Fingers Kids Meal** (all $14.99). They also provide **High chairs**.
- **Customization and Sides:** Patrons can fully customize their meals with a vast selection of homemade sauces and dressings, including **Schug**, **Amba**, **Spicy Mayo**, and **Garlic Mayo** ($0.95 each). Sides range from **Garlic Fries** ($7.99) and **Sweet Potato Fries** ($8.99) to **Hummus**, **Israeli Salad**, and **Corn Salsa** (all $8.99).
To experience the unique and satisfying Kosher fast food at Schnitzel +, here is the essential contact information.
**Address:** 1450 Queen Anne Rd, Teaneck, NJ 07666, USA
**Phone:** (201) 833-2301
**Mobile Phone:** +1 201-833-2301
For locals in the New Jersey area, **Schnitzel +** is worth choosing for several compelling reasons that go beyond the typical fast-food experience. The most significant factor is its dual specialty: providing **high-quality, flavorful fast food** that is also strictly **Kosher**. This fills a vital need in the community, offering convenience without compromising on dietary requirements or taste.
The sheer **breadth of the menu** is a major draw. You can satisfy a craving for a traditional American burger or chicken fingers, or you can opt for authentic Israeli specialties like **Sabich** and **Shawarma**. The quality is consistently high, with customers praising the restaurant’s meticulous **cleanliness** and the **taste and quality** of the food, even simple items like the chicken fingers, which are noted for their generous portions. The daily **Lunch Specials** offer incredible value, providing a full, satisfying meal at a great price point during the workday. Finally, the welcoming staff and excellent **accessibility** features make it a comfortable, stress-free dining destination for every member of the family or group. Schnitzel + is not just a place to grab a quick meal; it's a reliable, delicious, and community-focused establishment in Teaneck that truly serves a local specialty.
Schnitzel + Vibe
*LUNCH SPECIAL(11am 2:30pm) - Lunch Special (11 am to 2:30pm)
- Lunch Special Falafel Pita
- Lunch Special Shawarma Pita
- Lunch Special Pita Sandwich
- Lunch Special Sabich Pita
- Lunch Special 6 Chicken Fingers
- Lunch Special Burger
Lunch Special (11 am to 2:30pm)
- Lunch Special Falafel Pita
- Lunch Special Shawarma Pita
- Lunch Special Pita Sandwich
- Lunch Special Sabich Pita
- Lunch Special 6 Chicken Fingers
- Lunch Special Burger
FOOD - Chicken Sandwiches Fried/Grilled
- Classic Sandwich
lettuce, tomato, mayo
- Mexican Sandwich
corn salsa, avocado, spicy mayo
- Israeli Sandwich
israeli salad, pickles, hummus, tahini
- Pretzel Sandwich
sauteed onion, tomato, honey mustard
- BBQ Sandwich
coleslaw, pickles, bbq sauce
- BYO Sandwich
- Shawarma Sandwich
Israeli salad, Pickles, Hummus, Tahini
- Falafel Pita
Israeli salad, Pickles, Hummus, Tahini
- Sabich Pita $12.95
Hummus,Israeli salad,hard Boil Egg,Thahini ,Amba
- Challa Yumyum Schnitzel Sandwich $17.99
Challa bun,Moroccan tomato matbucha,Fried eggplant,Thaini.
FOOD - Chicken Fingers
- 6 Chicken Fingers $14.95
- 12 Chicken Fingers $27.95
- 24 Chicken Fingers $49.95
- 48 Chicken Fingers $84.95
- 6 Pretzel Fingers $15.95
- 12 Pretzel Fingers $29.95
- 24 Pretzel Fingers $51.95
- 48 Pretzel Fingers $87.95
FOOD - Burgers
- Original Burger
lettuce, Tomato, Red onion, Pickles, Special sauce
- Egg & Onion Burger
Fried egg, Tomato, Sauteed onion, Special sauce
- Jersey Burger
Sauteed mushroom, Sauteed onion ,Tomato, Special sauce
- BBQ Burger
Coleslaw, Pickles, Bbq sauce
- Slider Burger $5.99
tomato & pickles
- California Burger
Avocado, Tomato, Egg, Special sauce
FOOD - Fries & Sides
- French Fries $6.99
- Garlic Fries $7.99
- Sweet Potato Fries $8.99
- Onion Rings $8.99
- 4 Falafel Balls $3.99
small tahini on side
- Coleslaw 12 Oz $8.99
- Corn Salsa 12 Oz $8.99
- Hummus 12 Oz $8.99
- Israeli Salad 12oz $8.99
- Pickles 12oz $5.00
- Half Sliced Avocado $4.95
- Smash Avocado 12 Oz $8.25
- Sauteed Onion 12 Oz $5.00
- Tahini 12 Oz $6.50
- Hot Dog In Bun $6.99
- Crunchy Hot Dog $6.25
- Rice 12oz $6.99
- Hard Boiled Egg $1.50
FOOD - Salads
- Mexican Salad $14.99
iceberg lettuce, corn salsa ,avocado, red onion
- Healthy Salad $14.99
Iceberg lettuce ,Shredded carrots. Corn, Cucumber, Tomato.
- Portobello Salad $14.99
Iceberg lettuce, Tomato, Eggplant, Roasted red pepper, Corn
- Sabich Salad $14.99
Iceberg lettuce, Tomato, Cucumber,Eggplant,Pickles,Hard boiled eggs
- Quinoa Salad $14.99
Iceberg lettuce, Beets,Cucumber, Chickpeas,Dry cranberries
- BYO Salad $14.99
FOOD - Platters
- Half Platter W/One Side $21.99
- Grilled Chicken Platter $29.99
- Classic Schnitzel Platter $29.99
- Pretzel Schnitzel Platter $29.99
- Shawarma Platter $29.99
FOOD - Homemade Soup
- 12oz Chicken Soup $7.99
- 16oz Chicken Soup $8.99
- 16oz Lentil Soup $8.99
- 12oz Lentil Soup $6.99
- Xlg Lentil Soup 32 Oz (To Go Only) $14.99
- Xlg Chicken Soup 32 Oz (To Go Only) $15.99
FOOD - Kids Menu
- Hot Dog Kids Meal $14.99
- Chicken Fingers Kids Meal (3 Pc) $14.99
- Pretzel Fingers Kids Meal(3pc) $14.99
- Sliders Kids Meal(2) $14.99
FOOD - Meats
- 1 Piece Schnitzel $10.00
- 1 Piece Grilled Chicken $7.95
- 1 Piece Pretzel $11.00
- One Burger Patty $9.00
- 1 Shawarma Half Portion $12.00
FOOD - Breads
- Pita $1.75
- 6" Baguette $2.50
- 12" Baguette $4.95
- 24" Baguette $7.95
- Laffa $4.75
- Whole Wheat Wrap $1.99
- Hot Dog Bun $1.50
- Gluten Free Bun $3.50
- Burger Bun $2.50
FOOD - Sweets
- Lg Chocolate Chip Cookies $4.95
- Smores Chocolate Chips Cookies $4.95
- 3 Sm Chocolate Chips Cookies $3.75
FOOD - Dressings
- 3 Oz Balsamic Vinagrette $0.95
- 3 Oz Garlic Mayo $0.95
- 3 Oz Spicy Mayo $0.95
- 3 Oz Special Sauce $0.95
- 3 Oz Lemon Olive Oil $0.95
- 3 Oz BBQ $0.95
- 3 Oz Tahini $0.95
- 3 Oz Honey Mustard $0.95
- 3 Oz Sweet Chilli $0.95
- 3 Oz Buffalo $0.95
- Schug $0.95
- 3 Oz Amba $0.95
- Ketchup $0.00
- Mustard $0.00
- 12 Oz Sauce $6.00
- 16 Oz Sauce $9.00
FOOD - Make it a Meal
- Make It A Meal Reg Fries
- Make It A Meal Sm Garlic Fries
Chicken Sandwiches Fried/Grilled
- Classic Sandwich
lettuce, tomato, mayo
- Mexican Sandwich
corn salsa, avocado, spicy mayo
- Israeli Sandwich
israeli salad, pickles, hummus, tahini
- Pretzel Sandwich
sauteed onion, tomato, honey mustard
- BBQ Sandwich
coleslaw, pickles, bbq sauce
- BYO Sandwich
- Shawarma Sandwich
Israeli salad, Pickles, Hummus, Tahini
- Falafel Pita
Israeli salad, Pickles, Hummus, Tahini
- Sabich Pita $12.95
Hummus,Israeli salad,hard Boil Egg,Thahini ,Amba
- Challa Yumyum Schnitzel Sandwich $17.99
Challa bun,Moroccan tomato matbucha,Fried eggplant,Thaini.
Chicken Fingers
- 6 Chicken Fingers $14.95
- 12 Chicken Fingers $27.95
- 24 Chicken Fingers $49.95
- 48 Chicken Fingers $84.95
- 6 Pretzel Fingers $15.95
- 12 Pretzel Fingers $29.95
- 24 Pretzel Fingers $51.95
- 48 Pretzel Fingers $87.95
Burgers
- Original Burger
lettuce, Tomato, Red onion, Pickles, Special sauce
- Egg & Onion Burger
Fried egg, Tomato, Sauteed onion, Special sauce
- Jersey Burger
Sauteed mushroom, Sauteed onion ,Tomato, Special sauce
- BBQ Burger
Coleslaw, Pickles, Bbq sauce
- Slider Burger $5.99
tomato & pickles
- California Burger
Avocado, Tomato, Egg, Special sauce
Fries & Sides
- French Fries $6.99
- Garlic Fries $7.99
- Sweet Potato Fries $8.99
- Onion Rings $8.99
- 4 Falafel Balls $3.99
small tahini on side
- Coleslaw 12 Oz $8.99
- Corn Salsa 12 Oz $8.99
- Hummus 12 Oz $8.99
- Israeli Salad 12oz $8.99
- Pickles 12oz $5.00
- Half Sliced Avocado $4.95
- Smash Avocado 12 Oz $8.25
- Sauteed Onion 12 Oz $5.00
- Tahini 12 Oz $6.50
- Hot Dog In Bun $6.99
- Crunchy Hot Dog $6.25
- Rice 12oz $6.99
- Hard Boiled Egg $1.50
Salads
- Mexican Salad $14.99
iceberg lettuce, corn salsa ,avocado, red onion
- Healthy Salad $14.99
Iceberg lettuce ,Shredded carrots. Corn, Cucumber, Tomato.
- Portobello Salad $14.99
Iceberg lettuce, Tomato, Eggplant, Roasted red pepper, Corn
- Sabich Salad $14.99
Iceberg lettuce, Tomato, Cucumber,Eggplant,Pickles,Hard boiled eggs
- Quinoa Salad $14.99
Iceberg lettuce, Beets,Cucumber, Chickpeas,Dry cranberries
- BYO Salad $14.99
Platters
- Half Platter W/One Side $21.99
- Grilled Chicken Platter $29.99
- Classic Schnitzel Platter $29.99
- Pretzel Schnitzel Platter $29.99
- Shawarma Platter $29.99
Homemade Soup
- 12oz Chicken Soup $7.99
- 16oz Chicken Soup $8.99
- 16oz Lentil Soup $8.99
- 12oz Lentil Soup $6.99
- Xlg Lentil Soup 32 Oz (To Go Only) $14.99
- Xlg Chicken Soup 32 Oz (To Go Only) $15.99
Kids Menu
- Hot Dog Kids Meal $14.99
- Chicken Fingers Kids Meal (3 Pc) $14.99
- Pretzel Fingers Kids Meal(3pc) $14.99
- Sliders Kids Meal(2) $14.99
Meats
- 1 Piece Schnitzel $10.00
- 1 Piece Grilled Chicken $7.95
- 1 Piece Pretzel $11.00
- One Burger Patty $9.00
- 1 Shawarma Half Portion $12.00
Breads
- Pita $1.75
- 6" Baguette $2.50
- 12" Baguette $4.95
- 24" Baguette $7.95
- Laffa $4.75
- Whole Wheat Wrap $1.99
- Hot Dog Bun $1.50
- Gluten Free Bun $3.50
- Burger Bun $2.50
Sweets
- Lg Chocolate Chip Cookies $4.95
- Smores Chocolate Chips Cookies $4.95
- 3 Sm Chocolate Chips Cookies $3.75
Dressings
- 3 Oz Balsamic Vinagrette $0.95
- 3 Oz Garlic Mayo $0.95
- 3 Oz Spicy Mayo $0.95
- 3 Oz Special Sauce $0.95
- 3 Oz Lemon Olive Oil $0.95
- 3 Oz BBQ $0.95
- 3 Oz Tahini $0.95
- 3 Oz Honey Mustard $0.95
- 3 Oz Sweet Chilli $0.95
- 3 Oz Buffalo $0.95
- Schug $0.95
- 3 Oz Amba $0.95
- Ketchup $0.00
- Mustard $0.00
- 12 Oz Sauce $6.00
- 16 Oz Sauce $9.00
Make it a Meal
- Make It A Meal Reg Fries
- Make It A Meal Sm Garlic Fries
DRINKS - Soft drink
- Coke $2.50
- Sprite $2.50
- Coke Zero $2.50
- Water $1.75
- Diet Coke $2.50
- Ginger Ale $2.50
- Selzter Water $2.50
- Juice Box $1.75
- Zero Sugar Peach Snapple $3.50
- Peach Snapple $3.50
- Raspberry Snapple $3.50
- Sugar Free Rasberry Snapple $3.50
- Strawberry Kiwi Snapple $3.50
- Gatorade Fruit Punch $3.50
- Gatorade Lemon Lime $3.50
- Gatorade Cool Blue $3.50
Soft drink
- Coke $2.50
- Sprite $2.50
- Coke Zero $2.50
- Water $1.75
- Diet Coke $2.50
- Ginger Ale $2.50
- Selzter Water $2.50
- Juice Box $1.75
- Zero Sugar Peach Snapple $3.50
- Peach Snapple $3.50
- Raspberry Snapple $3.50
- Sugar Free Rasberry Snapple $3.50
- Strawberry Kiwi Snapple $3.50
- Gatorade Fruit Punch $3.50
- Gatorade Lemon Lime $3.50
- Gatorade Cool Blue $3.50
Catering - Salads (half tray)9 by 13
- Healthy Salad (Half Tray)9 By 13 $65.00
Iceberg lettuce ,Shredded carrots. Corn, Cucumber, Tomato.
- Sabich Salad
- Mexican Salad
- Portabello Salad
- Quinoa Salad
- Israeli Salad
- Healthy Salad ( Full Tray) $120.00
Catering - Protein meat (half or full tray)
- Chicken Fingers
- Pretzel Chicken Fingers
- Grilled Chicken
- Schnitzel
- Pretzel Schnitzel
- Shawarma
Catering - Fries
- French Fries
- Sweet Potato Fries
- Garlic Fries
- Onion Rings
Catering - Sandwiches Platters
- Sm. Sandwich Platter (Up To 12 Ppl) $180.00
- Lg. Sandwich Platter (Up To 16 Ppl) $210.00
Catering - Sides
- Corn Salsa
- Cole Slaw
- Hummus
- Tahini
- Rice
Catering - Cookies Platters
- Small Platter (10 Lg Cookies) $40.00
- Large Platter (25 Lg Cookies) $95.00
Salads (half tray)9 by 13
- Healthy Salad (Half Tray)9 By 13 $65.00
Iceberg lettuce ,Shredded carrots. Corn, Cucumber, Tomato.
- Sabich Salad
- Mexican Salad
- Portabello Salad
- Quinoa Salad
- Israeli Salad
- Healthy Salad ( Full Tray) $120.00
Protein meat (half or full tray)
- Chicken Fingers
- Pretzel Chicken Fingers
- Grilled Chicken
- Schnitzel
- Pretzel Schnitzel
- Shawarma
Fries
- French Fries
- Sweet Potato Fries
- Garlic Fries
- Onion Rings
Sandwiches Platters
- Sm. Sandwich Platter (Up To 12 Ppl) $180.00
- Lg. Sandwich Platter (Up To 16 Ppl) $210.00
Sides
- Corn Salsa
- Cole Slaw
- Hummus
- Tahini
- Rice
Cookies Platters
- Small Platter (10 Lg Cookies) $40.00
- Large Platter (25 Lg Cookies) $95.00
Schnitzel + Details
Service options
- Delivery
- Takeout
- Dine-in
Highlights
- Serves local specialty
Popular for
- Lunch
- Dinner
- Solo dining
Accessibility
- Wheelchair accessible entrance
- Wheelchair accessible parking lot
- Wheelchair accessible restroom
- Wheelchair accessible seating
Offerings
- Comfort food
- Late-night food
- Quick bite
- Small plates
Dining options
- Lunch
- Dinner
- Catering
- Dessert
- Seating
- Table service
Amenities
- Restroom
Atmosphere
- Casual
- Trendy
Crowd
- College students
- Groups
- Tourists
Planning
- Accepts reservations
Payments
- Credit cards
- Debit cards
- NFC mobile payments
- Credit cards
Children
- Good for kids
- High chairs
- Kids' menu
Parking
- Free parking lot
- Free street parking
- Parking
Schnitzel + Photos










Schnitzel + Location
Schnitzel + Reviews
burgerchicken fingersfast foodshawarmakidsfalafelsidespaypitato go
★ 5★ 4★ 3★ 2★ 1The food here is simply amazing. Finding a restaurant this clean is rare and you can tell the kitchen and front staff are meticulous about their cleanliness. The whole restaurant was spotless. The staff were so friendly and eager to answer any questions. I will definitely be coming back.
July 01 · Emmanuel AbanesI had the buffalo chicken fingers. The portion was very well sized the dressing on the side was a generous portion. I was so happy with the taste and quality definitely will return.
September 17 · FuridDecent amount of chicken. Solid sandwich, good timing on order but it was just missing that speciality. You know when you just have to say to yourself “wow that was really good”…..it’s like getting there but it needs a slight refinement. Still 7.7/10 on flavor but portions 🤦♂️.
August 31 · eli longmanIt is so easy to order online. The food is always ready without delay and the service is exceptional! They always aim to please. They are friendly and personable and if ever an issue arises they make sure the customer is taken care of.
August 21 · Gershon KravetzWe took out food, the chicken was fresh, perfectly sauced and delicious.This is our go to chicken spot!I’d give more than five stars if that was an option.
August 19 · Namy Jacob
More restaurants near me

1448A Queen Anne Rd, Teaneck, NJ 07666, USA

1454 Queen Anne Rd, Teaneck, NJ 07666, USA

1448 Queen Anne Rd, Teaneck, NJ 07666, USA

1389 Queen Anne Rd, Teaneck, NJ 07666, USA

195 Englewood Ave, Teaneck, NJ 07666, USA

172 W Englewood Ave A, Teaneck, NJ 07666, USA

Inside Poppy's Bagels, 204 W Englewood Ave, Teaneck, NJ 07666, USA

166 W Englewood Ave, Teaneck, NJ 07666, USA

1356 A Queen Anne Rd, Teaneck, NJ 07666, USA

198 W Englewood Ave, Teaneck, NJ 07666, USA

204 W Englewood Ave, Teaneck, NJ 07666, USA

206 W Englewood Ave, Teaneck, NJ 07666, USA
Categories
Top Visited Sites






Trending Dining Insights Posts





