Caraotas NYC: The Queens Hotspot for Venezuelan & American Fusion with Excellent Vegan Options

Caraotas Nyc - Arepas, Burgers & Milkshakes Introduce

Introduction / Overview

In the diverse culinary landscape of Queens, New York, finding a restaurant that expertly fuses cultural flavors while catering to modern dietary preferences is a true find. Caraotas NYC - Arepas, Burgers & Milkshakes is precisely that destination, establishing itself as a popular and dynamic Venezuelan and American fusion eatery located on Jamaica Avenue. The name "Caraotas" is a nod to the black beans central to Venezuelan cuisine, signifying the restaurant's commitment to authentic, flavorful foundations.

This unique establishment wears several hats—it functions as a Venezuelan Restaurant, a Fast Food Restaurant, a Hamburger Restaurant, and importantly, a Vegan Restaurant. This wide range of identities allows it to serve nearly every New Yorker, from families seeking a quick and tasty meal to vegan and vegetarian diners looking for creative, satisfying options. They pride themselves on using exotic vegetables and maintaining a high quality level, making it a reliable spot for both traditional comfort food lovers and those seeking healthier alternatives.

Caraotas NYC is particularly celebrated for its Arepas (the Venezuelan cornmeal patties), its loaded Burgers (including the famous Venezuelan Burger), and its extravagant, signature Milkshakes. Critically for the NYC area, it offers multiple dedicated Vegan Options, featuring Impossible™ meat in popular dishes like the Impossible Burger (VEGAN), the Vegan Arepa, and The Impossible Bowl (Vegan), ensuring that plant-based dining doesn't mean sacrificing flavor or excitement. Identifying as a Latino-owned business, Caraotas brings a vibrant, Casual, and Cozy atmosphere to the Woodhaven/Jamaica neighborhood, making it a truly enriching part of the local dining scene.

It is worth noting for frequent patrons that some customer feedback points toward occasional inconsistencies in food quality (specifically regarding rice and plantains in delivery orders) and operational issues, such as stock availability and counter service attitude. However, the initial positive experiences and the overall reputation for fresh, delicious, and diverse food options keep it highly popular among locals.

Location and Accessibility

Caraotas NYC is conveniently located on a major thoroughfare in Queens, making it easily accessible for customers across the borough and beyond. The physical address is:

92-02 Jamaica Ave, Queens, NY 11421, USA

Situated directly on Jamaica Avenue, the restaurant is well-positioned for both walk-in customers and delivery/takeout service. For New Yorkers concerned about access, Caraotas NYC makes inclusion a priority, offering several key accessibility features:

Wheelchair Accessible Entrance: Ensures ease of entry for all patrons.
Wheelchair Accessible Restroom: Provides comfortable and accessible facilities.
Wheelchair Accessible Seating: Ensures dining comfort inside the restaurant.

Parking options in the dense Queens neighborhood include both Free Street Parking and Paid Street Parking, offering flexibility for those who drive. Furthermore, its location is excellent for those utilizing public transportation in the area, contributing to its popularity for quick lunches, dinners, and solo dining outings.

Services Offered

Caraotas NYC provides a comprehensive range of food service options and amenities, establishing it as a highly versatile and accommodating establishment:

Dining Options: Offers Delivery, Takeout, and Dine-in services, covering Lunch, Dinner, and Dessert with dedicated Seating.
Menu Variety: Features a vast menu including Comfort Food, Halal Food, Organic Dishes, Quick Bites, Small Plates, and extensive Vegan Options and Vegetarian Options.
Dietary Inclusivity: Dedicated menu sections for vegan and vegetarian diners, including the Impossible Burger (VEGAN), Vegan Arepa, The Impossible Bowl (Vegan), and Impossible Empanada (Vegan).
Family Focus: Categorized as Family-friendly and Good for Kids, making it an excellent spot for family meals in Queens.
Amenities and Atmosphere: Provides Restrooms, a Gender-neutral restroom, and Wi-Fi. The atmosphere is described as Casual, Cozy, and Trendy.
Payment Methods: Accepts all major modern payment types, including Credit Cards, Debit Cards, and NFC Mobile Payments.

Features / Highlights

The strongest selling points of Caraotas NYC are its delicious food concepts, unique fusion style, and commitment to inclusivity:

Authentic Venezuelan-American Fusion: Excels at blending authentic Venezuelan staples (Arepas, Cachapas) with American fast-food favorites (Burgers, Milkshakes), creating a distinct and appealing menu.
Dedicated Vegan Menu: A major highlight for NYC diners is the extensive, high-quality Vegan Options, featuring Impossible™ meat substitutes in popular items like burgers, bowls, arepas, and empanadas—making it a true Vegan Restaurant destination.
Signature Items: Must-try items include the fully loaded Venezuelan Burger, the customizable Build Your Own Bowl, and the over-the-top, indulgent Caraotas Shakes.
Inclusivity and Accessibility: Excellent commitment to accessibility with a Wheelchair Accessible Entrance, Restroom, and Seating. Additionally, the business proudly Identifies as Latino-owned, contributing to the rich diversity of Queens' local businesses.
Perfect for All Crowds: Its Casual and Cozy atmosphere makes it popular for Solo Dining, Lunch, Dinner, and gathering with Groups and Family-friendly outings.

Contact Information

Caraotas Nyc - Arepas, Burgers & Milkshakes can be reached using the following information:

Address: 92-02 Jamaica Ave, Queens, NY 11421, USA

Phone: (347) 233-3873

What is Worth Choosing

Caraotas NYC is worth choosing because it represents the best of the Queens dining scene: a successful fusion of cultural flavor with modern convenience and dietary awareness. For New Yorkers, the sheer versatility of the menu is the main draw. Whether you're a devoted vegan craving an Impossible Burger (VEGAN), a tourist looking for an authentic taste of the Arepa Burger, or a parent needing a Family-friendly spot with great milkshakes and fast service, Caraotas delivers.

The restaurant’s commitment to providing excellent Vegan Options—not just one token dish, but a variety of Impossible™-based meals, including bowls, burgers, and empanadas—makes it a standout choice in a city increasingly seeking plant-based comfort food. The presence of Halal Food also expands its appeal, showing dedication to serving the diverse Queens community.

While some customer experiences have noted minor service or consistency issues with delivery, the overall reputation for fresh ingredients, unique flavors, and the highly accessible physical location with full Wheelchair Accessible amenities positions Caraotas NYC as an essential, trend-setting Latino-owned establishment on Jamaica Avenue. When you're in Queens and seeking an exciting meal that balances healthy choices with indulgent comfort, all delivered in a casual and friendly atmosphere, Caraotas NYC is the definitive choice.

Caraotas Nyc - Arepas, Burgers & Milkshakes Food & drink

Burgers
Impossible Burger (VEGAN) $11.95
Impossible patty, lettuce, onions, tomatoes
Choco Dubai-Pistachio $7.99
Double chocolate chocolate dough cookie with chocolate chips, filled with a crunchy mixture of filo dough (kataifi) with pistachio cream and tahini, full intensity with a crunchy center and full of flavor.
Venezuelan Burger 🥇 $12.95
6 oz. Burger patty lettuce, tomato, caramelized onions, cheese, egg, bacon, sprinkles fries, topped with our home made sauce.
Brooklyn Burger $13.95
Loaded 6 oz. Burger patty, lettuce, tomato, caramelized onions, cheese, egg, bacon, sprinkles fries & Guacamole topped with our home made sauce.
Pollo Mechado Burger $12.95
Shredded chicken, lettuce, tomato, caramelized onions, cheese, egg, bacon, sprinkles fries, topped with our home made sauce.
Nacho Bacon Fríes🥇(New) $9.95
Extra Crispy seasoned Fries topped with melted cheese, bacon crumbs, sour cream, pico de gallo.
Cheeseburger $9.75
6 oz. Burger patty brisket blend, lettuce, tomato, onions, cheese, topped with our home made sauce.
Carne Mechada Burger $12.95
Burger, shredded beef, lettuce, tomato, caramelized onions, cheese, egg, bacon, sprinkles fries, topped with our home made sauce.
Pistachio Bliss $7.99
Soft pistachio dough cookie with white chocolate chips, filled with a creamy pistachio paste, a delicate bite full of flavor.
Double Cheeseburger $10.50
Double cheeseburger, lettuce, tomato, onions, cheese.

A Signature Bowls
Shredded Chicken Bowl $13.95
Shredded chicken, white rice, black beans, sweet plantains & lettuce & pico de gallo.
The Impossible Bowl (Vegan) $14.95
Impossible blend, white rice, black beans, sweet plantains & lettuce & pico de gallo.
Pabellon Criollo Bowl $14.95
Shredded beef, white rice, black beans, sweet plantains mozzarella cheese & fried egg.
Pistachio Bliss $7.99
Soft pistachio dough cookie with white chocolate chips, filled with a creamy pistachio paste, a delicate bite full of flavor.
Shredded Beef Bowl $14.95
Shredded beef white rice, black beans, sweet plantains & lettuce & pico de gallo.
Grilled Chicken Barbacoa Bowl $14.95
Choco Dubai-Pistachio $7.99
Double chocolate chocolate dough cookie with chocolate chips, filled with a crunchy mixture of filo dough (kataifi) with pistachio cream and tahini, full intensity with a crunchy center and full of flavor.
Pernil Bowl $14.95
Pulled pork, white rice, black beans, sweet plantains & lettuce & pico de gallo.

Mini Bites
Venezuelan Snack Combo $14.95
Choose 1 Drink - choose 2 Dishes - Choose 1 Snack
4 Mini Arepas Frita $6.95
4 corn flower mini arepas, with sour cream & COTIJA grated cheese on the side
Cheese Tequeno $8.95
Five units and with Nutella for additional charge.
Nacho Bacon Fríes🥇(New) $9.95
Extra Crispy seasoned Fries topped with melted cheese, bacon crumbs, sour cream, pico de gallo.
Yuca Fries $5.75
Crispy yuca fries served with a side of creamy dipping sauce.
Seasoned French Fries $4.95
Extra crispy home seasoned fries

Build Your Own Bowl
Sopa De Res (Beef Soup) 32oz $12.95
Best soup in town, made With beef Bone & chuck tender beef seasoned with organic vegetables, topped with cilantro
Build Your Own Bowl🥇 $14.95
Step 1: choose your base step 2: choose your protein step 3: choose your 4 toppings step 4: choose your sauce
Choco Dubai-Pistachio $7.99
Double chocolate chocolate dough cookie with chocolate chips, filled with a crunchy mixture of filo dough (kataifi) with pistachio cream and tahini, full intensity with a crunchy center and full of flavor.
Small Sopa De Res 16oz $5.99
Best soup in town, made With beef Bone & chuck tender beef seasoned with organic vegetables, topped with cilantro

Snacks
Venezuelan Snack Combo $14.95
Choose 1 Drink - choose 2 Dishes - Choose 1 Snack
Susy $2.50
Cocosette $2.50
Samba. $2.50

Empanadas
Small Sopa De Res 16oz $5.99
Best soup in town, made With beef Bone & chuck tender beef seasoned with organic vegetables, topped with cilantro
Caraotas (Black Beans) $3.95
Pabellon Empanada $4.25
Shredded beef, sweet plantains, black beans and cheese.
Impossible Empanada (Vegan) $4.95
A golden-brown empanada filled with a savory plant-based meat alternative.
Cheese Empanada $3.95
Crispy pastry filled with melted cheese.
Chicken Empanada $3.50
Chicken & Cheese $3.95
Chicken & american cheese.
Domino Empanada $3.75
Black beans & mozzarella Cheese.
Chicken, Corn And Bacon Empanada $3.95
Sopa De Res (Beef Soup) 32oz $12.95
Best soup in town, made With beef Bone & chuck tender beef seasoned with organic vegetables, topped with cilantro

Caraotas Shakes
Chocolate Shake $7.95
Chocolate Ice cream, blended with Chocolate cream Always good with a burger
Pistachio Shake $8.25
Pistachio Ice cream base, blended with pistachio crunch Always good with a burger
Peanut Butter Shake $8.50
Vanilla base, blended with Crunch Peanut butter Always good with a burger
Choco Dubai-Pistachio $7.99
Double chocolate chocolate dough cookie with chocolate chips, filled with a crunchy mixture of filo dough (kataifi) with pistachio cream and tahini, full intensity with a crunchy center and full of flavor.
Oreo Cookie Shake $8.50
Oreo Cookie Ice cream, blended with oreo cookie Crumbs Always good with a burger
Cotton Candy Shake $8.50
Vanilla ice cream, blended with Cotton candy base Always good with a burger
Vanilla Shake $7.95
Vanilla Ice cream, blended with our Homemade Vanilla Syrup Always good with a burger
Pistachio Bliss $7.99
Soft pistachio dough cookie with white chocolate chips, filled with a creamy pistachio paste, a delicate bite full of flavor.
Strawberry Shake $7.95
Strawberry Ice cream, blended with strawberry sauce Always good with a burger

Combos
Choco Dubai-Pistachio $7.99
Double chocolate chocolate dough cookie with chocolate chips, filled with a crunchy mixture of filo dough (kataifi) with pistachio cream and tahini, full intensity with a crunchy center and full of flavor.
#2. Double Cheeseburger Combo $16.45
Onions, cheese, lettuce and tomatoes. Includes french fries and Small soda.
Venezuelan Snack Combo $14.95
Choose 1 Drink - choose 2 Dishes - Choose 1 Snack
#1. Cheeseburger Combo $14.45
Onions, cheese, lettuce and tomatoes. Includes french fries and Small soda.

Best Soup in Town
Sopa De Res (Beef Soup) 32oz $12.95
Best soup in town, made With beef Bone & chuck tender beef seasoned with organic vegetables, topped with cilantro
Small Sopa De Res 16oz $5.99
Best soup in town, made With beef Bone & chuck tender beef seasoned with organic vegetables, topped with cilantro

Cachapas
Cachapa Venezolana $13.95
Stuffed with queso de mano topped with crema nata and grated cheese.
Sopa De Res (Beef Soup) 32oz $12.95
Best soup in town, made With beef Bone & chuck tender beef seasoned with organic vegetables, topped with cilantro
Cachapa Carne Mechada $14.50
Sweet corn pancakes stuffed with mozzarella cheese topped w/ crema nata, grated cheese and shredded meat
Vegan Cachapa $14.95
Stuffed with impossible meat, lettuce and tomatoes.
Cachapa Pollo Mechado $13.95
Sweet corn pancakes filled with mozzarella cheese topped w/ crema nata, grated cheese and shredded chicken.
Choco Dubai-Pistachio $7.99
Double chocolate chocolate dough cookie with chocolate chips, filled with a crunchy mixture of filo dough (kataifi) with pistachio cream and tahini, full intensity with a crunchy center and full of flavor.
Small Sopa De Res 16oz $5.99
Best soup in town, made With beef Bone & chuck tender beef seasoned with organic vegetables, topped with cilantro
Cachapa Pernil (Pulled Pork) $13.95
Sweet corn pancakes filled with mozzarella cheese topped w/ crema nata, grated cheese and pulled pork.
Cachapa Dominicana $14.95
Stuffed with salami, fried cheese lettuce, tomatoes and tartara sauce.

Beverages
Fanta Orange $2.95
Malta Polar $3.95
Rich, non-alcoholic malt beverage with a deep, caramel flavor.
Passion Fruit Juice $4.00
(parchita)
Diet Coke $2.95
Diet coke, choice of small or large, crisp cola flavor.
Peach Snapple $2.99
Water Bottle $2.00
Natural artesian water from fiji, sourced from an aquifer in the yaqara valley.
(Diet) Peach Snapple $2.99
Choco Dubai-Pistachio $7.99
Double chocolate chocolate dough cookie with chocolate chips, filled with a crunchy mixture of filo dough (kataifi) with pistachio cream and tahini, full intensity with a crunchy center and full of flavor.
Agua Panela (Venezuelan Lemonade) $3.95
Sweetened with panela (unrefined cane sugar), this venezuelan lemonade offers a unique twist on the classic beverage.
Sprite $2.95
Crisp, refreshing soda available in small or large sizes.
Coke $2.95
Cola, available in small or large sizes.
Hi-C Fruit Punch $2.95
Hi-c fruit punch: refreshing blend, available in small or large.
Frescolita $2.99
Satisfy your thirst with this refreshing, effervescent venezuelan classic.
Ginger - Ale $2.95
Ginger ale, available in small or large sizes.
Strawberry Kiwi Snapple $2.99
Sanpellegrino Sparkling $2.99
Flavor; Melograno & Arancia

Tequenos
Cheese Tequeno $8.95
Five units and with Nutella for additional charge.

Arepas
Pernil Arepa (Pulled Pork) $11.95
pulled pork & cheese
Carne Mechada Arepa (Shredded Beef) $11.95
Shredded beef & cheese
Pollo Mechado Arepa (Chicken) $11.95
Shredded chicken & cheese
Vegan Arepa $12.95
Impossible soy blend, lettuce, avocado, pico de gallo & sweet plantains
Cheese Arepa $10.95
Grilled cornmeal cake filled with shredded cheese.
Arepa De Pabellon $11.95
Shredded beef, black beans, sweet plantain, and fried egg.
Reina Pepiada Arepa $11.95
Stuffed with chicken and avocado mix.
Build Your Own Arepa $12.50
Step 1: choose your protein step 2: choose your 3 toppings step 3: choose your sauce.
Arepa Burger $13.95
4 oz. burger, lettuce, tomato, caramelized onions, cheese, bacon, fried egg, house sauce.

NY Style Cookies (Made by Bake Dream)
Choco Chip Storm $7.99
An explosive combination: half chocolate chip dough, half double chocolate dough, with a creamy nutella center, pure storm of flavor in every bite
Red Love Bite $7.99
A soft red velvet cookie with white chocolate chips, filled with creamy cheesecake, a classic with an irresistible touch.
Choco Dubai-Pistachio $7.99
Double chocolate chocolate dough cookie with chocolate chips, filled with a crunchy mixture of filo dough (kataifi) with pistachio cream and tahini, full intensity with a crunchy center and full of flavor.
Oats Power $5.99
A nutritious and energetic cookie with oat dough, walnut chunks, raisins and a subtle touch of cinnamon, perfect for those looking for flavor and texture in every bite.
Pistachio Bliss $7.99
Soft pistachio dough cookie with white chocolate chips, filled with a creamy pistachio paste, a delicate bite full of flavor.
Pistachio Dubai-Nutella $7.99
White chocolate chip pistachio dough biscuit, filled with a crispy mixture of phyllo dough (kataifi) with nutella and tahini, an explosion of intense textures and flavors

Patacones
Patacon Pernil $11.95
Pulled pork, lettuce, tomato, onions, cheese. Topped with our homemade sauce.
Patacon Carne Mechada $12.95
Shredded beef, lettuce, tomato, onions, cheese. Topped with our homemade sauce.
Patacón Mixto ( Mixed ) $14.95
Stuffed with chicken, beef & pork lettuce, tomato, onions, cheese. Topped with our homemade sauces.
Small Sopa De Res 16oz $5.99
Best soup in town, made With beef Bone & chuck tender beef seasoned with organic vegetables, topped with cilantro
Sopa De Res (Beef Soup) 32oz $12.95
Best soup in town, made With beef Bone & chuck tender beef seasoned with organic vegetables, topped with cilantro
Patacon Pollo Mechado $11.95
Shredded chicken, lettuce, tomato, onions, cheese. Topped with our homemade sauce.
Vegan Patacon $13.95
IMPOSSIBLE SOY MEAT WITH LETTUCE, TOMATO, ONIONS, GUACAMOLE TOPPED WITH OUR HOME MADE SAUCES

Caraotas Nyc - Arepas, Burgers & Milkshakes Details

From the business
Identifies as Latino-owned

Service options
Delivery
Takeout
Dine-in

Popular for
Lunch
Dinner
Solo dining

Accessibility
Wheelchair accessible entrance
Wheelchair accessible restroom
Wheelchair accessible seating

Offerings
Comfort food
Halal food
Organic dishes
Quick bite
Small plates
Vegan options
Vegetarian options

Dining options
Lunch
Dinner
Dessert
Seating
Table service

Amenities
Gender-neutral restroom
Restroom
Wi-Fi
Wi-Fi

Atmosphere
Casual
Cozy
Trendy

Crowd
Family-friendly
Groups
Tourists

Planning
Accepts reservations

Payments
Credit cards
Debit cards
NFC mobile payments
Credit cards

Children
Good for kids

Parking
Free street parking
Paid street parking
Parking

Pets
Dogs allowed
Dogs allowed inside
Dogs allowed outside

Caraotas Nyc - Arepas, Burgers & Milkshakes Photos

Caraotas Nyc - Arepas, Burgers & Milkshakes Picture 1

Caraotas Nyc - Arepas, Burgers & Milkshakes Picture 2

Caraotas Nyc - Arepas, Burgers & Milkshakes Picture 3

Caraotas Nyc - Arepas, Burgers & Milkshakes Picture 4

Caraotas Nyc - Arepas, Burgers & Milkshakes Picture 5

Caraotas Nyc - Arepas, Burgers & Milkshakes Picture 6

Caraotas Nyc - Arepas, Burgers & Milkshakes Picture 7

Caraotas Nyc - Arepas, Burgers & Milkshakes Picture 8

Caraotas Nyc - Arepas, Burgers & Milkshakes Picture 9

Caraotas Nyc - Arepas, Burgers & Milkshakes Location

Caraotas Nyc - Arepas, Burgers & Milkshakes

New York Queens County Woodhaven Jamaica Avenue

92-02 Jamaica Ave, Queens, NY 11421, USA

Caraotas Nyc - Arepas, Burgers & Milkshakes Reviews

An average rating of ★4.2 from 168 user reviews.

bowlpricesdeliverycachapaempanadasatmospheretastefriesplantainspabellon

★ 5★ 4★ 3★ 2★ 1

I order frequently from this place on uber eats and it was super delicious, hot, and fresh. Last three times I’ve order has been terrible. I kept thinking it’s a one off situation but THREE times. Today the rice was hard which lets me know the rice is old. The plantains have been cold, black and old all 3 times. The bowl also is severely less food every time. Unfortunately, this is the last time I order Caraotas.
August 31 · L Ramirez
Now the first I came here it was a delight. The second time made me not want to come back. My issue was when I proceeded to order from the menu at hand. The person behind the counter then pulls the menu from me and tells me they do not have any of the milkshakes I want. Yet last time I was here they had them. Now for good customer service, you don't pull menus from your customers. You politely let them know you do not have the stock for the milkshakes/person who makes them.
May 29 · David Lopez
The burger tastes super good and so does the fries. Decent price for the quality !
September 16 · Milly Barnicals
Love trying new places within my Queens county when looking for dinner.Seen this place before since I ate next door.The place as you walk in gives you a very cool relaxed feeling with wood tables black paint on the walls and beautiful floor.I ordered a bowl and it’s basically a bowl similar to Chipotle but with a twist, they offer plantains. Everything was really good and fresh!!! I ordered brown rice, shredded beef, corn, cheese, cilantro, lettuce pico de gallo and topped it off with chipotle sauce. It was excellent taste about the only thing I can say is the beef was a tad too salty. My wife had the pulled pork and that was perfect. Next time I will order the pulled pork.Loved this place. Would recommend.
August 05 · Geo M.
I ordered an item on Uber eats and it took 1.5 hours to get here with the person saying they are still making it and I ordered at 10:00pm so I assumed it wouldn’t be that busy. Around 11:05 was when the order was finally picked up. Finally got my order at 11:35 and no utensils or napkins in my bag and the food was cold.
August 15 · Joseph Q