Jerry's Hot Chicken Introduce
Introduction / Overview
For New Jersey food lovers, the search for truly exceptional fried chicken often leads to a delightful discovery in Bergen County: Jerry's Hot Chicken in Fair Lawn. While the name immediately conjures images of Southern heat, this establishment distinguishes itself by masterfully blending the bold, spicy tradition of Nashville Hot Chicken with the distinct, light, and hyper-crispy technique of Korean Fried Chicken (K-Fried Chicken). Jerry’s Hot Chicken is classified as a Korean restaurant, a Fried chicken takeaway, and a full-service Chicken restaurant, reflecting its versatile and dynamic menu that appeals to a wide range of local tastes.
Located centrally in Fair Lawn, Jerry’s Hot Chicken has quickly become a local favorite for its commitment to high-quality, made-fresh-to-order poultry. Customers rave about the food, often citing the Huge juicy chicken breast used in their signature sandwiches and the perfect balance of crispiness and succulence in their wings and tenders. This Bergen County spot provides a cozy and welcoming setting for families, couples, and individuals seeking flavorful comfort food for Lunch, Dinner, or even Brunch on the weekends.
The genius of Jerry’s lies in its dual-genre approach, allowing patrons to choose their adventure: the intense, slow-burn heat of Nashville style, or the savory, often sauced, and incredibly crunchy Korean style. This unique culinary concept makes it a stand-out destination in the New Jersey dining scene, appealing to both heat seekers and those who prefer a rich, savory experience like their famously addictive Soy Garlic Chicken.
***
Location and Accessibility
Jerry's Hot Chicken is conveniently situated at 7-09 Fair Lawn Ave, Fair Lawn, NJ 07410, USA. This prime location in Fair Lawn ensures easy accessibility for residents across Bergen County and beyond. The vibrant commercial area allows for a seamless visit, whether you are planning to dine in or pick up a quick meal.
Accessibility is a key priority for the restaurant, ensuring a comfortable experience for all patrons:
- The establishment offers a Wheelchair accessible entrance, providing necessary ease of access for all guests.
- For those driving, the restaurant provides a convenient combination of Free parking lot and Free street parking options, removing the stress of finding a spot in a busy New Jersey town.
- Its location on Fair Lawn Avenue places it along a major local thoroughfare, making it simple to navigate to for both local patrons and those commuting from neighboring towns like Paramus, Glen Rock, and Hackensack.
The modern, comfortable seating area inside also allows customers a pleasant spot to wait for their Takeout orders or enjoy their meal immediately after it is prepared fresh.
***
Services Offered
Jerry's Hot Chicken is dedicated to providing maximum convenience and a complete dining experience through a variety of service options:
- Dining Options: The restaurant offers full Seating for customers who wish to enjoy their meal on-site. It operates for Brunch, Lunch, and Dinner throughout the week.
- Takeout and Delivery: For customers on the go, Jerry’s offers fast and reliable Takeout service, as well as convenient options for Curbside pickup and local Delivery, ensuring you can enjoy their food anywhere in the area.
- Catering Services: Large party platters and customized packages are available for Catering events, making it the perfect choice for office lunches, private parties, or game-day gatherings.
- Payment Flexibility: The establishment accepts a wide range of payment methods, including Credit cards, Debit cards, and NFC mobile payments, alongside traditional Checks.
- Family-Friendly Atmosphere: Jerry’s Hot Chicken is recognized as Good for kids, with an environment and menu suitable for younger diners, making it a stress-free choice for family outings.
The general operating hours are a generous reflection of its commitment to serving the community:
- Sunday - Thursday: 11:00 am - 8:30 pm
- Friday - Saturday: 11:00 am - 9:00 pm
***
Features and Highlights
The menu and dining philosophy at Jerry's Hot Chicken contain several distinguishing elements that contribute to its high praise from local New Jersey diners:
- Dual Chicken Specialties: The menu is sectioned into two primary styles: Jerry's Chicken (Nashville Hot style, with customizable heat levels from No Seasoning to XHot) and Korean Fried Chicken (offered in sauces like Soy Garlic and Spicy Soy Garlic, known for their double-fried crunch).
- Signature Sandwiches: Their Classic Chicken Sandwich features a Huge juicy chicken breast served on a brioche bun with creamy coleslaw and house-made pickles, hailed by customers as a must-try item.
- Jerry's Fries: A unique and highly praised side dish—a generous portion of fries topped with juicy chunks of chicken breast, cheese, and their proprietary Jerry's sauce, making it a full comfort meal in itself.
- Homemade Sides: The restaurant is known for its fresh, house-made accompaniments, including their Super flavorful coleslaw and their Super crunchy and delicious pickles that are noted for being perfectly balanced and not too salty.
- Inclusion of Korean Sides: While focusing on chicken, the inclusion of crispy and delicious Dumplings (offered in Chicken and Vegetable or Beef varieties) further solidifies its identity as a welcoming Korean-style eatery in Fair Lawn.
- Dietary Accommodations: The menu thoughtfully includes dedicated options for Vegan options and Vegetarian options, ensuring that all members of the family or party can find a satisfying, flavorful dish.
***
Contact Information
To plan your visit, place an order for Takeout or Delivery, or inquire about Catering, please use the following contact details for Jerry's Hot Chicken:
Address: 7-09 Fair Lawn Ave, Fair Lawn, NJ 07410, USA
Phone: (201) 402-9300
***
What is Worth Choosing
For New Jersey residents seeking a truly satisfying and memorable meal, Jerry’s Hot Chicken is worth choosing for its uncompromising quality and innovative menu. The core appeal lies in the flawless execution of their chicken—it is consistently praised for being perfectly crisp on the outside, juicy on the inside, and always cooked fresh to order.
If you are a first-time visitor, you should absolutely opt for a piece of their Korean Fried Chicken, particularly the Soy Garlic Chicken. As one customer noted, the sauce is downright addictive, delivering a savory, umami-rich flavor that is a hallmark of authentic K-Fried Chicken. Pair this with a side of the Creamy, cheesy Mac and Cheese for the perfect comfort combination. Alternatively, if you are looking for an American twist, the Chicken Sandwich is a showstopper, or you can satisfy a massive craving with the piled-high Jerry's Fries.
Jerry’s Hot Chicken is more than a fast-food spot; it is a dedicated Korean restaurant that provides a vibrant, flavorful, and reliable dining experience. It offers a culinary passport right in Fair Lawn, giving local Bergen County diners a taste of both Nashville heat and Seoul’s legendary crunch, all under one roof. The combination of friendly service, consistent quality, and a diverse menu makes it a local gem that guarantees a delicious bite every time.
Jerry's Hot Chicken Details
Service options
- Curbside pickup
- Delivery
- Takeout
Accessibility
- Wheelchair accessible entrance
- Wheelchair accessible parking lot
Offerings
- Comfort food
- Vegan options
- Vegetarian options
Dining options
- Brunch
- Lunch
- Dinner
- Catering
- Counter service
- Dessert
- Seating
Payments
- Checks
- Credit cards
- Debit cards
- NFC mobile payments
- Credit cards
Children
- Good for kids
Parking
- Free parking lot
- Free street parking
- Parking
Jerry's Hot Chicken Photos










Jerry's Hot Chicken Location
Jerry's Hot Chicken
7-09 Fair Lawn Ave, Fair Lawn, NJ 07410, USA
Jerry's Hot Chicken Reviews
chicken sandwichwingsspicyfriespricepickledcoleslawcrispysoy garlictenders
★ 5★ 4★ 3★ 2★ 1Get the Chicken Sandwich!!!They were made fresh to order. Huge juicy chicken breast for the chicken sandwich. The coleslaw is super flavorful. Chicken wings and tenders are all very juicy, and quite large. Fast friendly service. Jerry's fries were fantastic. It's a bed of fries, topped with juicy chunks of chicken breast topped with Jerry's sauce and cheese. The beef dumplings were crispy, chewy and delicious. Get some soy garlic sauce to dip them in, that sauce is amazing. The pickles were super crunchy and delicious and not too salty which was a very refreshing surprise. There's comfortable seating area inside while you wait for your order. Definitely will be back to try more stuff.
June 27 · Madeleine ParkJerry’s Hot Chicken is an absolute gem! We tried their soy garlic chicken, and it was packed with flavor — perfectly crisp on the outside, juicy on the inside, and that sauce was downright addictive. The mac and cheese was creamy, cheesy, and the perfect comfort side. Everything we had was spot on and left us planning our next visit before we even finished. If you’re in Fair Lawn and looking for a delicious bite, Jerry’s is a must-try!
June 23 · Aqua RiservaI accidentally came across this place in my travels.The chicken is cooked fresh, so there was a bit of a wait. The wait was well worth it!!!!Portions were huge !!! The chicken was cooked to perfection, and the flavor was spot on. I'm so happy to have tried this place.The establishment was clean and had a few chairs so that you could sit and wait while your food was being cooked. It is not an eat in establishment.Parking can be a bit challenging as it's street parking only.
October 27 · Celeste C."What did they even do to this chicken...?"Unbelievably crispy — the crunch was so loud it almost hurt my ears (in the best way possible). The sauce was a unique sweet-and-spicy combo, and most importantly, the chicken was super juicy and fresh. They don’t pre-fry anything; everything is made to order, so it takes a bit of time, but honestly, it's worth the wait. If you're in a rush, just call ahead and pick it up fresh.You can tell they use quality ingredients or maybe really clean oil — either way, it felt light and easy on the stomach, which is rare with fried chicken. This wasn’t your typical fried chicken; it was something new and different.We had half Jerry’s Original and half Korean-style (mild), and both were fantastic. The portions were huge — more than enough for four people. Compared to a popular buffalo wing chain I tried a few days ago, Jerry’s chicken was not only juicier and bigger but also way more satisfying. The wings I had before were decent and felt cleanly cooked, but the serving was tiny. Jerry’s is in another league when it comes to value.Parking was super easy — there’s street parking and even a municipal lot right across the street.
May 02 · Paul Soo EoJerry’s Hot Chicken is absolutely delicious. The chicken is perfectly crispy, juicy, and packed with flavor. The rub they use is incredible—bold, balanced, and just the right amount of heat.On top of that, the service was exceptional. The staff went above and beyond to make the experience welcoming and enjoyable.Portions are generous, prices are more than fair, and the overall quality is unbeatable. I can’t rave about this place enough—it’s a must-visit
May 20 · Mariana Soler Jimenez
More restaurants near me
New Territories Ice Cream4.0 (165 reviews)13-24 River Rd, Fair Lawn, NJ 07410, USA
Better Daze Cafe4.0 (22 reviews)13-20 River Rd, Fair Lawn, NJ 07410, USA
FLAC Bar and Catering Hall/Fair Lawn Athletic Club4.0 (187 reviews)14-19 Parmelee Ave, Fair Lawn, NJ 07410, USA
poke express4.0 (320 reviews)12-74 River Rd, Fair Lawn, NJ 07410, USA
A&V Bagel & Cafe4.0 (17 reviews)12-74 River Rd, Fair Lawn, NJ 07410, USA
Carvel4.0 (132 reviews)12-72 River Rd, Fair Lawn, NJ 07410, USA
Dunkin'3.0 (255 reviews)12-18 River Rd, Fair Lawn, NJ 07410, USA
Starbucks4.0 (836 reviews)16 31 208, Fair Lawn, NJ 07410, USA
Habit Burger & Grill4.0 (1421 reviews)3101 Promenade Blvd, Fair Lawn, NJ 07410, USA
Anthony's Coal Fired Pizza & Wings4.0 (757 reviews)2101 Promenade Blvd, Fair Lawn, NJ 07410, USA
Mei Sushi Japanese Restaurant3.0 (187 reviews)14-20 Plaza Rd N, Fair Lawn, NJ 07410, USA
Panera Bread3.0 (877 reviews)23-02 Fair Lawn Ave, Fair Lawn, NJ 07410, USA
Categories
Top Visited Sites
Dave & Buster's Wayne4.0 (5397 reviews)
Magnolia Bakery – LaGuardia Airport: LGA2.0 (26 reviews)
NEVER GIVE UP PROTEIN SHAKES4.0 (11 reviews)
China King3.0 (158 reviews)
Flores Coffee Shop5.0 (7 reviews)
巨有味(砂锅土豆粉) Fire Noodles4.0 (21 reviews)Top restaurants Searches
Trending Dining Insights Posts
Exploring American Restaurants That Offer Creative Seasonal Menus
Discovering Sushi Restaurants That Focus on Ethical and Sustainable Sourcing
How to Find the Best Brunch Buffets Near Me: A Food Lover’s Dream Come True
The Role of Tea Houses in Preserving Traditional Tea Culture
How Chocolate Shops Are Collaborating With Local Artisans for Special Editions
Discovering Ice Cream Shops That Combine Classic and Modern Flavors
