Dine Droop
Dine DroopDining Insightsrestaurants near me
ConnecticutNew JerseyNew York

Dine Drooprestaurants near meNew YorkQueens CountyFar Rockawayrestaurants in Cornaga AvenuePopeyes Louisiana Kitchen
Popeyes Louisiana Kitchen ico

Popeyes Louisiana Kitchen
- 14-26 Cornaga Ave, Far Rockaway, NY 11691

Chicken restaurant, Cajun restaurant ★3.0 (66)·$10–20

14-26 Cornaga Ave, Far Rockaway, NY 11691, USA

3.0
Ordered* through uber eats. Got pink chicken and they didn't give me 12 but 10 pieces of chicken each box! - Ti Jo
Popeyes Louisiana Kitchen Overview Intro Fried chicken Detail Photos Location Reviews
$10–20 per person Reported by 66 people$1–10$10–20$20–30$30–50

Popeyes Louisiana Kitchen Introduce

Introduction / Overview: Your Local Taste of Louisiana in Far Rockaway

Popeyes Louisiana Kitchen is a global brand that has firmly established itself in the New York market, bringing the bold, distinctive flavors of Louisiana to local diners. The Far Rockaway location at 14-26 Cornaga Ave stands as a local hub for 'Chicken restaurant,' 'Cajun restaurant,' and 'Seafood restaurant' fare. While primarily known for its signature fried chicken, this location provides the full experience of the brand's identity, which is rooted in its New Orleans heritage.

The dining experience is designed to be highly accessible and casual, with an 'Atmosphere' that is decidedly relaxed. It is a reliable option for all demographics, popular for 'Lunch,' 'Dinner,' and 'Solo dining,' and is well-suited for 'Family-friendly' outings, 'Groups,' and 'Tourists' visiting the area. The menu is a blend of hearty 'Comfort food' and convenient 'Quick bite' options, perfect for the pace of life in Queens. Furthermore, the inclusion of 'Late-night food' is a massive convenience for New Yorkers working late or seeking a midnight snack. The operational setup offers a wide array of choices for ordering, from 'Outdoor seating' to 'No-contact delivery,' ensuring maximum flexibility for the local customer base. This location is positioned to be a highly functional and frequent stop for the Far Rockaway community.

Location and Accessibility: Anchoring Cornaga Avenue

This Popeyes Louisiana Kitchen is located at 14-26 Cornaga Ave, Far Rockaway, NY 11691, USA. Cornaga Avenue is a well-known thoroughfare in Far Rockaway, a highly populated neighborhood in Queens, making the restaurant easily locatable for both pedestrian traffic and drivers. The site's location within this established area ensures strong community integration and accessibility.

Accessibility for all customers is a clear priority at this location, featuring essential amenities that New Yorkers expect. The facility offers a 'Wheelchair accessible entrance,' 'Wheelchair accessible restroom,' and 'Wheelchair accessible seating,' demonstrating a commitment to inclusivity. Parking is also managed efficiently for this area, providing patrons with 'Free parking lot,' 'Free street parking,' and 'On-site parking' options, which is a significant convenience in the often-challenging parking environment of NYC. The wide range of service options, from 'Curbside pickup' to 'Delivery,' further ensures that the restaurant's offerings are available to the local community, regardless of their mode of transport or physical ability.

Services Offered: Catering to Every Customer Need

The service model at the Far Rockaway Popeyes is comprehensive, utilizing virtually every modern service option to maximize customer convenience.

The extensive services offered include:

  • Outdoor Seating: Providing an option for al fresco dining when the weather permits.
  • Curbside Pickup: An efficient service allowing customers to receive their order directly to their vehicle.
  • No-Contact Delivery and Standard Delivery: Offering maximum convenience for home or office enjoyment, with an emphasis on safety.
  • Takeout and Dine-in: The traditional options for quick pick-up or casual dining on-site.
  • Full Dining Options: Available for 'Lunch,' 'Dinner,' and 'Dessert,' with 'Counter service' and dedicated 'Seating.'
  • Catering: Providing services for larger orders, ideal for parties, office lunches, or family gatherings.
  • All-Day Accessibility: Offering 'Late-night food' to meet diverse scheduling needs.
  • Family and Group Amenities: Being 'Good for kids' and providing a 'Kids' menu' and accommodating 'Groups.'
  • Digital Convenience: Providing 'Wi-Fi' and accepting all major modern payment methods, including Credit cards, Debit cards, and NFC mobile payments.

Features / Highlights: Signature Flavor and Variety

The menu at Popeyes Louisiana Kitchen is characterized by its signature Cajun seasoning and an impressive variety of meal options, ranging from individual items to large family packs.

Key features and menu highlights include:

  • Iconic Chicken Sandwiches: Available in 'Classic Chicken Sandwich,' 'Spicy Chicken Sandwich,' and the 'Ghost Pepper Sandwich,' all priced at $7.99, also available in combos ($15.49).
  • Signature Chicken and Tenders: Offering various sizes of 'Signature Chicken' (e.g., 8Pc for $27.99, 16Pc for $49.99) and 'Handcrafted Tenders' (e.g., 5Pc for $16.99), perfect for customizable meals.
  • Cajun-Inspired Sides: The selection includes unique offerings like 'Homestyle Mac & Cheese' ($8.49), 'Red Beans & Rice' ($8.79), 'Cajun Fries' ($8.79), and 'Mashed Potatoes With Cajun Gravy' ($8.79), alongside their famous 'Biscuit' ($9.99).
  • Seafood Offering: Fulfilling its 'Seafood restaurant' designation with the '¼ Pound Popcorn Shrimp*' ($11.99), also available as a combo ($15.49).
  • Wing Variety: Featuring a wide range of wings, including new flavors, available in bone-in and boneless options, with deals like the '18 Wing Group Pack' ($34.19).
  • Family Value: Offering various 'Group Meals' and 'Family Meal' bundles, such as the '12Pc Signature Chicken Family Meal' ($56.99), designed for groups and cost-conscious diners.
  • Dessert and Beverage Selection: Providing sweet finishes like 'Strawberry Cream Cheese Pie' ($4.99) and a range of frozen and chilled lemonades.

Contact Information: Connect with Popeyes Far Rockaway

For local New York patrons looking to place an order or inquire about catering, the following contact details are provided.

  • Address: 14-26 Cornaga Ave, Far Rockaway, NY 11691, USA
  • Phone (Local): (718) 327-4754
  • Phone (Mobile/Primary): +1 718-327-4754

What is Worth Choosing: Flavor, Variety, and Cautionary Consideration

Popeyes Louisiana Kitchen in Far Rockaway is worth choosing for the immense variety of its menu, its signature Cajun flavors, and its unparalleled operational convenience (offering late-night food, curbside pickup, and full accessibility). For New Yorkers seeking comfort food staples like the famous chicken sandwich, Cajun fries, or the '¼ Pound Popcorn Shrimp*,' this location offers the full breadth of the brand’s popular items. The extensive menu, especially the family meal options, makes it a highly economical choice for feeding groups.

However, a factual and professional assessment must include transparency regarding customer feedback. While the menu and services are comprehensive, customer reviews for this specific location raise significant red flags. Patrons have reported issues with food quality, specifically 'pink chicken,' which is a serious food safety concern, and problems with inaccurate orders ('didn't give me 12 but 10 pieces'). Furthermore, there are distressing reports of extremely long wait times and serious, unsubstantiated allegations of racial discrimination by staff. The business explicitly notes that there is 'Usually a wait.'

Therefore, the choice to visit is best made with awareness. Patrons are encouraged to prioritize safety by visually checking food quality before consumption, verifying orders immediately upon receipt, and using the available service options (like delivery) for convenience. While the brand promises bold flavor and variety, the local experience, based on recent customer reports, suggests that patrons should proceed with a degree of caution and be prepared for potential service delays, while trusting that the management is actively working to resolve these concerning quality and service issues to meet the high standards expected by the New York community.

Popeyes Louisiana Kitchen Fried chicken

  • Group Meals

  • 18 Wing Group Pack $34.19

    [Feeds 3-4] 18 wings in up to 3 flavors, 3 dipping sauces, and a large side. Choose bone-in or boneless or mix the two! Plenty to go around!

  • 12Pc Signature Chicken Family Meal $56.99

    [Feeds 4-6] 12 pieces of signature chicken with 2 large sides and 6 buttermilk biscuits to satisfy the whole family.

  • 8Pc Signature Chicken Family Meal $44.99

    [Feeds 3-4] 8 juicy pieces of signature chicken paired with a large side and 4 buttermilk biscuits - a classic meal.

  • 16Pc Signature Chicken Family Meal $68.99

    [Feeds 6-8] 16 pieces of juicy signature chicken with 3 large sides and 8 buttermilk biscuits.

  • Wings 2 Can Dine $18.49

    6 wings (bone-in or boneless), 3 tenders, 2 sides, and 2 biscuits. A hearty meal for two to enjoy together.

  • 24 Wing Group Pack $29.09

    [Feeds 4 - 6] Share the love with 24 wings in up to 4 flavors, 4 dipping sauces, and a large side. Choose bone-in or boneless or mix the two! Party time!

  • Wings & Sandwiches Bundle $24.99

    12 wings (up to 2 flavors). Choose bone-in or boneless or mix the two! 2 sandwiches, and a large side. A crowd-pleasing combo!

  • Desserts

  • Strawberry Cream Cheese Pie $4.99

    Crispy fried pie filled with strawberry and cream cheese​

  • Caramel Apple Cheesecake $4.49

    Indulge in rich cheesecake swirled with a sweet and tangy caramel apple filling over a buttery graham cracker crust.

  • Cinnamon Apple Pie $4.96

    A warm, crispy pie crust encasing a gooey cinnamon-apple filling. Comfort in every bite.

  • Signature Chicken

  • 16Pc Signature Chicken $49.99

    [Feeds 6-8] 16 big pieces of the signature chicken to satisfy the heartiest appetites. A family-sized feast!

  • 8Pc Signature Chicken $27.99

    [Feeds 3-4] 8 pieces of Popeyes' signature seasoned and fried chicken. Perfectly portable protein.

  • 12Pc Signature Chicken $39.99

    [Feeds 4-6] A hefty serving of 12 pieces of that signature, juicy fried chicken. Enough for all!

  • Beverages

  • Frozen Lemonades $5.49
  • Bottled Water $2.29
  • Iced Teas $0.00
  • Soft Drinks $0.00
  • Chilled Lemonades $5.49
  • Chicken Sandwiches

  • Classic Chicken Sandwich $7.99

    A fried chicken breast filet with pickles and classic mayo on a buttered bun. The original handheld favorite.

  • Spicy Chicken Sandwich $7.99

    A kicked-up fried chicken sandwich with pickles and spicy mayo on a buttered bun. A fiery fan favorite!

  • Ghost Pepper Sandwich $7.99

    Our buttermilk battered all white meat chicken breast featuring our all-new Ghost Pepper Sauce. Served on a butter toasted brioche bun with barrel cured pickles.

  • Signature Sides and Sauces

  • Homestyle Mac & Cheese $8.49

    Creamy, cheesy macaroni baked to golden perfection. A comforting classic.

  • Red Beans & Rice $8.79

    Flavorful red beans served over a bed of seasoned rice. A taste of Louisiana.

  • Cajun Fries $8.79

    Fries seasoned with authentic Cajun spices, delivering a bold and savory kick.

  • Mashed Potatoes With Cajun Gravy $8.79

    Velvety mashed potatoes smothered in savory Cajun-style gravy. A rich indulgence.

  • Biscuit $9.99

    Freshly baked buttermilk biscuits, flaky on the outside and soft on the inside - a perfect pairing.

  • Wing Sauces $0.90
  • Coleslaw $8.79

    A crisp and tangy cabbage slaw, adding a fresh crunch to your meal.

  • Dipping Sauces $0.75
  • Tenders

  • 12Pc Handcrafted Tenders $39.99

    [Feeds 4-6] 12 chicken tenders marinated and fried with Louisiana herbs and seasonings. Includes 4 dipping sauces.

  • 5Pc Handcrafted Tenders $16.99

    5 chicken tenders of your choice marinated and fried with Louisiana herbs and seasonings. Includes 2 dipping sauces

  • 3Pc Handcrafted Tenders $13.99

    3 chicken tenders of your choice marinated and fried with Louisiana herbs and seasonings. Includes 1 dipping sauce

  • 16Pc Handcrafted Tenders $49.99

    [Feeds 6-8] A hearty serving of 16 handcrafted tenders with 5 dipping sauces. Twice the tender fun!

  • Combos

  • 3Pc Tenders Combo $17.99

    3 handcrafted tenders with a side, drink and a buttermilk biscuit. A compact taste of tender perfection.

  • 5Pc Tenders Combo $20.49

    5 handcrafted tenders complemented by a side, drink and a buttermilk biscuit. Satisfying simplicity.

  • 2Pc Signature Chicken Combo $14.99

    Two pieces of Popeyes' signature juicy, seasoned chicken with a side, buttermilk biscuit and a drink. Simple perfection.

  • Ghost Pepper Sandwich Combo $15.49

    Our buttermilk battered all white meat chicken breast featuring our all-new Ghost Pepper Sauce. Served on a butter toasted brioche bun with barrel cured pickles. Served with 1 regular side and 1 drink.

  • 6 Classic Boneless Wings Combo $14.49

    6 Piece Boneless Wings marinated In Louisiana spices and fried to perfection for unmatched flavor. Made with all-white meat, these wings are available in a range of spice levels and delectable flavors. Includes 1 dipping sauce. Served with 1 regular side and 1 drink.

  • 6 Classic Bone-In Wings Combo $14.49

    6 Crispy, golden chicken wings marinated in a lightly seasoned mild blend, then hand-breaded and fried to perfection. These wings deliver the ideal balance of crunch and flavor —perfect for those who love bold taste without the heat. Served with 1 regular side and 1 drink.

  • 3Pc Signature Chicken Combo $17.99

    Three pieces of the signature chicken coupled with a tasty side, buttermilk biscuit and a drink. Satisfaction guaranteed.

  • 12 Mix & Match Wings Combo $21.99

    Indulge in 12 crispy wings with up to 2 flavors, a regular side, drink, and 2 dipping sauces. Choose bone-in or boneless or mix the two! Double the deliciousness!

  • ¼ Pound Popcorn Shrimp Combo* $15.49

    Quarter pound of crispy popcorn shrimp with a side, buttermilk biscuit, and a drink. Shrimp never tasted so good!

  • Spicy Chicken Sandwich Combo $15.49

    The spicy chicken sandwich with a side and drink to cool things down.

  • 4Pc Signature Chicken Combo $20.49

    Four pieces of that signature chicken goodness served with a side, buttermilk biscuit and a drink. Plenty to savor.

  • Classic Chicken Sandwich Combo $15.49

    The classic sandwich paired with a side and drink. An iconic combo meal.

  • Seafood

  • ¼ Pound Popcorn Shrimp* $11.99

    Quarter pound of our crispy popcorn shrimp.

  • New & Limited Time Offerings

  • Fansville Wings Deal $17.49

    Get a regular fountain drink for free when you buy 12pc wings.

  • Honey Mustard Wrap $4.79

    Our hand-breaded chicken tender, topped with crisp lettuce, shredded cheddar cheese, barrel-cured pickle and honey mustard sauce, all wrapped in a soft flour tortilla.

  • 6 Classic Boneless Wings $8.99

    6 Piece Boneless Wings marinated In Louisiana spices and fried to perfection for unmatched flavor. Made with all-white meat, these wings are available in a range of spice levels and delectable flavors. Includes 1 dipping sauce.

  • 6 Classic Bone-In Wings $8.99

    6 Crispy, golden chicken wings marinated in a lightly seasoned mild blend, then hand-breaded and fried to perfection. These wings deliver the ideal balance of crunch and flavor —perfect for those who love bold taste without the heat.

  • Wrap Regular Combo $11.29

    Choose a wrap of your choice (Classic, Spicy or Honey Mustard). Served with 1 side and 1 drink.

  • Classic Wrap $4.79

    Our hand-breaded chicken tender, topped with crisp lettuce, shredded cheddar cheese, barrel-cured pickle and classic mayo, all wrapped in a soft flour tortilla.

  • Spicy Wrap $4.79

    Our hand-breaded chicken tender, topped with crisp lettuce, shredded cheddar cheese, barrel-cured pickle and spicy mayo, all wrapped in a soft flour tortilla.

  • Wings (New Flavors!)

  • 24 Mix & Match Wings $34.49

    A platter of 24 wings with up to 4 flavors. Choose bone-in or boneless or mix the two! 4 dipping sauces make it a flavor adventure!

  • 6 Classic Boneless Wings $8.99

    6 Piece Boneless Wings marinated In Louisiana spices and fried to perfection for unmatched flavor. Made with all-white meat, these wings are available in a range of spice levels and delectable flavors. Includes 1 dipping sauce.

  • 6 Classic Bone-In Wings $8.99

    6 Crispy, golden chicken wings marinated in a lightly seasoned mild blend, then hand-breaded and fried to perfection. These wings deliver the ideal balance of crunch and flavor —perfect for those who love bold taste without the heat.

  • 12 Mix & Match Wings $17.49

    Savor 12 crispy wings with up to 2 flavors. Choose bone-in or boneless or mix the two! Two dipping sauces let you explore more tastes.

Popeyes Louisiana Kitchen Details

  • Service options

  • Outdoor seating
  • Curbside pickup
  • No-contact delivery
  • Delivery
  • Takeout
  • Dine-in
  • Popular for

  • Lunch
  • Dinner
  • Solo dining
  • Accessibility

  • Wheelchair accessible entrance
  • Wheelchair accessible restroom
  • Wheelchair accessible seating
  • Offerings

  • Comfort food
  • Late-night food
  • Quick bite
  • Small plates
  • Dining options

  • Lunch
  • Dinner
  • Catering
  • Counter service
  • Dessert
  • Seating
  • Table service
  • Amenities

  • Restroom
  • Wi-Fi
  • Wi-Fi
  • Atmosphere

  • Casual
  • Crowd

  • Family-friendly
  • Groups
  • Tourists
  • Planning

  • Usually a wait
  • Accepts reservations
  • Payments

  • Credit cards
  • Debit cards
  • NFC mobile payments
  • Credit cards
  • Children

  • Good for kids
  • Kids' menu
  • Parking

  • Free parking lot
  • Free street parking
  • On-site parking

Popeyes Louisiana Kitchen Photos

Popeyes Louisiana Kitchen Picture 1Popeyes Louisiana Kitchen Picture 2Popeyes Louisiana Kitchen Picture 3Popeyes Louisiana Kitchen Picture 4Popeyes Louisiana Kitchen Picture 5Popeyes Louisiana Kitchen Picture 6Popeyes Louisiana Kitchen Picture 7Popeyes Louisiana Kitchen Picture 8Popeyes Louisiana Kitchen Picture 9Popeyes Louisiana Kitchen Picture 10

Popeyes Louisiana Kitchen Location

Popeyes Louisiana Kitchen

14-26 Cornaga Ave, Far Rockaway, NY 11691, USA

Popeyes Louisiana Kitchen Reviews

An average rating of ★3.8 from 521 user reviews.

chicken sandwichcashierpricespicyfrieswingsmoneyappbiscuitschicken wraps

★ 5★ 4★ 3★ 2★ 1

More restaurants near me

  • Lucky CornagaLucky Cornaga3.0 (126 reviews)

    14-20 Cornaga Ave, Far Rockaway, NY 11691, USA

  • SunnySunny4.0 (269 reviews)

    10-41 Beach 20th St, Far Rockaway, NY 11691, USA

  • Grand OasisGrand Oasis3.0 (9 reviews)

    16-11 Central Ave, Far Rockaway, NY 11691, USA

  • Island Rock Restaurant & BarIsland Rock Restaurant & Bar5.0 (1 reviews)

    7-11A Beach 20th St, Far Rockaway, NY 11691, USA

  • Chapines BakeryChapines Bakery3.0 (25 reviews)

    7-09 Beach 20th St, Far Rockaway, NY 11691, USA

  • Island Bay DeliIsland Bay Deli5.0 (3 reviews)

    20-08 Cornaga Ave, Far Rockaway, NY 11691, USA

  • CarvelCarvel5.0 (8 reviews)

    20-24 Mott Ave, Far Rockaway, NY 11691, USA

  • Deli grocery shef pepinDeli grocery shef pepin4.0 (24 reviews)

    21-07 Cornaga Ave, Far Rockaway, NY 11691, USA

  • NAS DELI AND GRILL CORPNAS DELI AND GRILL CORP3.0 (24 reviews)

    21-40 Mott Ave, Far Rockaway, NY 11691, USA

  • McDonald'sMcDonald's3.0 (2050 reviews)

    21-41 Mott Ave, Far Rockaway, NY 11691, USA

  • Magic WokMagic Wok4.0 (274 reviews)

    11-45 Beach Channel Dr, Far Rockaway, NY 11691, USA

  • Los Latinos Mini Market Corp.Los Latinos Mini Market Corp.3.0 (23 reviews)

    13-01 Redfern Ave, Far Rockaway, NY 11691, USA

  • Categories

    Top Visited Sites

    Top restaurants Searches

    Trending Dining Insights Posts