Popeyes Louisiana Kitchen Introduce
In a city as dynamic as New York, fast food often serves as a lifeline for busy residents and a comforting, familiar option for visitors. For those in Queens, and particularly in the diverse neighborhood of Jackson Heights, a craving for a taste of the American South is easily satisfied at Popeyes Louisiana Kitchen. This location on Northern Boulevard brings the iconic flavors of New Orleans-style fried chicken, tenders, and sandwiches right to the heart of the borough. As a well-known fast food restaurant, Popeyes offers a quick and convenient dining experience that doesn't compromise on flavor. It is a place that promises a consistent product, from its signature spicy chicken to its beloved biscuits and Cajun fries. The atmosphere is casual, making it a perfect spot for a no-fuss meal, whether you're dining alone or with family. The popularity of the restaurant for both lunch and dinner speaks to its role as a reliable and satisfying option for a variety of occasions. Popeyes stands as a testament to the idea that fast food can be both delicious and comforting, providing a familiar taste that transcends geographical boundaries. It is a go-to spot for those looking for a quick bite, a satisfying meal, or a family-friendly place to grab some food. The business has a clear identity and a well-established reputation for its Louisiana-inspired menu, which is a major draw for its wide-ranging customer base. For any New Yorker looking for a convenient and flavorful meal, Popeyes in Jackson Heights is a practical and tasty choice. The brand's commitment to its unique flavor profile is a significant reason for its enduring appeal and why it is a notable part of the local food scene. Its presence in the neighborhood is a source of comfort and convenience for many residents.
The overview of this Popeyes location highlights its identity as a chicken restaurant and a fast food destination. The menu is expansive, featuring a variety of options from their famous Signature Chicken in various sizes to Handcrafted Tenders and classic Chicken Sandwiches, including the popular Spicy and Ghost Pepper versions. For those looking for a lighter option, there are also wings, and for the seafood lovers, ¼ Pound Popcorn Shrimp. The menu's focus on "Comfort food" and "Quick bite" perfectly aligns with the fast food model, ensuring that customers get a satisfying and timely meal. The business is a popular choice for both "Lunch" and "Dinner," as well as "Solo dining," demonstrating its versatility. The "casual" atmosphere makes it a comfortable spot for everyone, and its reputation as "Family-friendly" with a "Kids' menu" ensures it's a practical option for parents. The variety of combos and group meals, such as the Wings & Sandwiches Bundle or the Signature Chicken group packs, also makes it a great choice for feeding a crowd. The menu is diverse enough to cater to different tastes and cravings, all while maintaining its core Louisiana-style identity. From sweet desserts like the Cinnamon Apple Pie to classic sides like Red Beans & Rice and Cajun Fries, the offerings are a full experience. This commitment to a comprehensive and flavorful menu is a key part of Popeyes' appeal and why it has such a strong following. The business understands its strengths and leverages them to provide a satisfying and consistent experience for its customers. It's a brand that has perfected its niche and delivers on its promise of delicious, quick-service food. The menu is a testament to the fact that fast food can be both convenient and a flavor-filled culinary adventure.
This Popeyes Louisiana Kitchen is located at 88-08 Northern Blvd, Jackson Heights, NY 11372, USA. Its address on Northern Boulevard, a major artery connecting several Queens neighborhoods, provides excellent visibility and accessibility. This prime location is a key factor in its success as a fast food restaurant, as it is easy to spot and get to for both drivers and those using public transportation. The restaurant also offers a "Free parking lot," which is a significant amenity in a busy urban area like Jackson Heights where parking can be a challenge. This makes it a highly convenient option for those with cars. For those who use public transit, Northern Boulevard is served by multiple bus routes, and the nearby subway stations on the 7, E, F, M, and R lines (at places like Jackson Heights-Roosevelt Ave) are within a reasonable travel distance. The combination of a free parking lot and accessible public transit ensures that the restaurant can serve a broad audience with minimal friction. The "Wheelchair accessible entrance" and "Wheelchair accessible restroom" also highlight the business's commitment to inclusivity and serving all members of the community. This thoughtful approach to accessibility is a key part of the modern fast food experience. The location's convenience and its robust accessibility features make it a reliable and practical choice for anyone in the Jackson Heights area looking for a quick and easy meal. It's a business that has clearly prioritized the customer experience, from the moment they decide to visit to the moment they leave. The strategic location is a major component of this customer-centric approach, ensuring that they can reach a wide range of patrons and provide a seamless experience.
The accessibility of this Popeyes location is a major selling point. The presence of a "Drive-through" is a highly convenient feature for customers on the go, allowing them to place an order and pick it up without leaving their car. The free parking lot further enhances this convenience. The restaurant also provides a variety of service options to cater to different customer preferences and needs, including:
- Outdoor seating: For those who prefer to dine in the open air, this is a great option.
- No-contact delivery & Delivery: For customers who want to enjoy their meal at home, these services offer a safe and convenient way to get their food.
- Takeout: A classic and efficient way to get food to go.
- Dine-in: The restaurant offers seating for customers who prefer to eat on-site and take a break.
These diverse service options demonstrate Popeyes' commitment to meeting the needs of a wide range of customers. Whether you're in a hurry and need to use the drive-through, want a meal delivered to your home, or prefer to sit and eat in a casual setting, the business has a service option for you. The amenities, such as a "Restroom" and "Wi-Fi," also contribute to a comfortable and convenient experience for dine-in customers. The business has clearly thought about every aspect of the customer journey, from the moment they place an order to the moment they finish their meal. This comprehensive approach to service is a key part of its appeal and is a major reason why it has become a go-to fast food spot in the neighborhood. They have successfully adapted the classic fast food model to fit the modern needs of a bustling urban environment. The variety of ways a customer can interact with the business is a testament to its forward-thinking and customer-focused approach. This is why it stands out as a practical and reliable choice for a quick and satisfying meal.
What makes this Popeyes a standout choice are the features and highlights that define the brand and its commitment to a quality product. These elements are a key part of its appeal to New Yorkers and tourists alike:
- Iconic Chicken Sandwich: The Spicy Chicken Sandwich is a major draw, with its distinctive flavor and reputation for being one of the best fast-food chicken sandwiches on the market. The availability of Classic and Ghost Pepper versions ensures there is a choice for every palate.
- Broad Menu: The menu is extensive, offering not just chicken but also seafood, wings, and a variety of sides and desserts. This breadth of options ensures that everyone in a group can find something they love. The availability of comfort food and quick bites makes it a practical choice for any occasion.
- Family-Friendly: With a kids' menu and a family-friendly atmosphere, it's an easy choice for a meal with children. This makes it a valuable resource for local families.
- Convenience: The presence of a drive-through, free parking lot, and multiple service options for delivery and takeout makes it an incredibly convenient option for a quick and easy meal.
These highlights demonstrate that Popeyes Louisiana Kitchen is a well-rounded and customer-focused fast food restaurant. While a customer review mentioned some issues with service, the business's core strengths—its delicious food, extensive menu, and commitment to convenience—are what truly set it apart. The brand's reputation for flavorful, Louisiana-style food is its greatest asset, and it is a powerful draw for new and returning customers. The focus on providing a consistent product, from the signature chicken to the classic sides, ensures that every visit is a satisfying one. For any New Yorker in need of a quick and delicious meal, this Popeyes location offers a reliable and flavorful solution. It is a place that understands its market and delivers exactly what its customers expect: great food, served quickly and conveniently. This dedication to its core mission is what makes it a cherished part of the local fast food scene. The business has clearly found a winning formula and executes it flawlessly, which is a major reason for its success and loyal customer base. It is a perfect example of a business that succeeds by focusing on the fundamentals and doing them exceptionally well. This is what builds a reputation and keeps customers coming back for more.
Popeyes Louisiana Kitchen Vibe
Tenders
- 8Pc Handcrafted Tenders $31.19
[Feeds 3-4] 8 plump, handcrafted tenders with 3 dipping sauces. Dive into saucy goodness!
- 5Pc Handcrafted Tenders $17.89
5 chicken tenders of your choice marinated and fried with Louisiana herbs and seasonings.
- 3Pc Handcrafted Tenders $14.79
3 chicken tenders of your choice marinated and fried with Louisiana herbs and seasonings.
- 12Pc Handcrafted Tenders $39.89
[Feeds 4-6] 12 chicken tenders marinated and fried with Louisiana herbs and seasonings. Includes 4 dipping sauces.
Combos
- Spicy Chicken Sandwich Combo $18.69
Introducing our new large combo with 2 sides and 1 large drink. Fried juicy chicken breast filet marinated in Popeyes seasonings and served on a butter toasted bun with pickles and spicy mayo.
- 2Pc Signature Chicken Combo $18.69
Two pieces of Popeyes' signature juicy, seasoned chicken with a side, buttermilk biscuit and a drink. Simple perfection. Upgrade to a LARGE COMBO with 2 sides and 1 large drink.
- 6 Classic Boneless Wings Combo $19.89
6 Piece Boneless Wings marinated In Louisiana spices and fried to perfection for unmatched flavor. Made with all-white meat, these wings are available in a range of spice levels and delectable flavors. Includes 1 dipping sauce. Served with 1 regular side and 1 drink.
- ¼ Pound Popcorn Shrimp Combo* $22.39
Crispy popcorn shrimp, a side, buttermilk biscuit, and drink. A shrimply delightful pairing. Upgrade to a LARGE COMBO with 2 sides and 1 large drink.
- 3Pc Handcrafted Tenders Combo $22.39
3 handcrafted tenders with a side, drink and a buttermilk biscuit. A compact taste of tender perfection. Upgrade to a LARGE COMBO with 2 sides and 1 large drink.
- 4Pc Signature Chicken Combo $25.59
Four pieces of that signature chicken goodness served with a side, buttermilk biscuit and a drink. Plenty to savor. Upgrade to a LARGE COMBO with 2 sides and 1 large drink.
- 3Pc Signature Chicken Combo $22.39
Three pieces of the signature chicken coupled with a tasty side, buttermilk biscuit and a drink. Satisfaction guaranteed. Upgrade to a LARGE COMBO with 2 sides and 1 large drink.
- Ghost Pepper Sandwich Combo $18.69
Our buttermilk battered all white meat chicken breast featuring our all-new Ghost Pepper Sauce. Served on a butter toasted brioche bun with barrel cured pickles. Served with 1 regular side and 1 drink. Upgrade to a LARGE COMBO with 2 sides and 1 large drink.
- Classic Chicken Sandwich Combo $18.69
Introducing our new large combo with 2 sides and 1 large drink. The classic sandwich paired with a side and drink. An iconic combo meal.
- 12 Mix & Match Wings Combo $27.39
Indulge in 12 crispy wings with up to 2 flavors, a regular side, drink, and 2 dipping sauces. Choose bone-in or boneless or mix the two! Double the deliciousness! Upgrade to a LARGE COMBO with 2 sides and 1 large drink.
- 5Pc Handcrafted Tenders Combo $25.59
5 handcrafted tenders complemented by a side, drink and a buttermilk biscuit. Satisfying simplicity. Upgrade to a LARGE COMBO with 2 sides and 1 large drink.
- 6 Classic Bone-In Wings Combo $19.89
6 Crispy, golden chicken wings marinated in a lightly seasoned mild blend, then hand-breaded and fried to perfection. These wings deliver the ideal balance of crunch and flavor —perfect for those who love bold taste without the heat. Served with 1 regular side and 1 drink.
Desserts
- Cinnamon Apple Pie $4.29
Warm, crispy crust on the outside, and hot cinnamon apple goodness on the inside.
- Strawberry Cream Cheese Pie $5.29
Crispy fried pie filled with strawberry and cream cheese
- Caramel Apple Cheesecake $4.69
Indulge in rich cheesecake swirled with a sweet and tangy caramel apple filling over a buttery graham cracker crust.
Seafood
- ¼ Pound Popcorn Shrimp* $11.79
A quarter pound of crispy, bite-sized shrimp. A seafood favorite!
Beverages
- Large Soft Drinks $5.59
- Chilled Lemonades $6.79
- Soft Drinks $4.29
- Bottled Water $3.69
- Iced Teas $5.59
- Frozen Lemonades $6.79
Group Meals
- 24 Wing Group Pack $32.39
[Feeds 3-4] Share the love with 24 wings in up to 4 flavors, 4 dipping sauces, and a large side. Choose bone-in or boneless or mix the two! Party time!
- Wings 2 Can Dine $19.89
6 wings (bone-in or boneless), 3 tenders, 2 sides, and 2 biscuits. A hearty meal for two to enjoy together.
- Wings & Sandwiches Bundle $27.21
12 wings (up to 2 flavors). Choose bone-in or boneless or mix the two! 2 sandwiches, and a large side. A crowd-pleasing combo!
- 18 Wing Group Pack $34.89
[Feeds 3-4] 18 wings in up to 3 flavors, 3 dipping sauces, and a large side. Choose bone-in or boneless or mix the two! Plenty to go around!
New & Limited Time Offerings
- 6 Classic Bone-In Wings $8.69
6 Crispy, golden chicken wings marinated in a lightly seasoned mild blend, then hand-breaded and fried to perfection. These wings deliver the ideal balance of crunch and flavor —perfect for those who love bold taste without the heat.
- 6 Classic Boneless Wings $8.69
6 Piece Boneless Wings marinated In Louisiana spices and fried to perfection for unmatched flavor. Made with all-white meat, these wings are available in a range of spice levels and delectable flavors. Includes 1 dipping sauce.
- Wrap Regular Combo $14.29
Choose a wrap of your choice (Classic, Spicy or Honey Mustard). Served with 1 side and 1 drink.
- Honey Mustard Wrap $4.89
Our hand-breaded chicken tender, topped with crisp lettuce, shredded cheddar cheese, barrel-cured pickle and wild honey mustard sauce, all wrapped in a soft flour tortilla.
- Spicy Wrap $4.89
Our hand-breaded chicken tender, topped with crisp lettuce, shredded cheddar cheese, barrel-cured pickle and spicy mayo, all wrapped in a soft flour tortilla.
- Classic Wrap $4.89
Our hand-breaded chicken tender, topped with crisp lettuce, shredded cheddar cheese, barrel-cured pickle and classic mayo, all wrapped in a soft flour tortilla.
- Fansville Wings Deal $17.29
Get a regular fountain drink for free when you buy 12pc wings.
Wings (New Flavors!)
- 24 Mix & Match Wings $34.59
A platter of 24 wings with up to 4 flavors. Choose bone-in or boneless or mix the two! 4 dipping sauces make it a flavor adventure!
- 6 Classic Bone-In Wings $8.69
6 Crispy, golden chicken wings marinated in a lightly seasoned mild blend, then hand-breaded and fried to perfection. These wings deliver the ideal balance of crunch and flavor —perfect for those who love bold taste without the heat.
- 12 Mix & Match Wings $17.29
Savor 12 crispy wings with up to 2 flavors. Choose bone-in or boneless or mix the two! Two dipping sauces let you explore more tastes.
- 6 Classic Boneless Wings $8.69
6 Piece Boneless Wings marinated In Louisiana spices and fried to perfection for unmatched flavor. Made with all-white meat, these wings are available in a range of spice levels and delectable flavors. Includes 1 dipping sauce.
Signature Chicken
- 16Pc Signature Chicken $49.89
[Feeds 6-8] 16 big pieces of the signature chicken to satisfy the heartiest appetites. A family-sized feast!
- 8Pc Signature Chicken $31.23
[Feeds 3-4] 8 pieces of Popeyes' signature seasoned and fried chicken. Perfectly portable protein.
- 12Pc Signature Chicken $39.89
[Feeds 4-6] A hefty serving of 12 pieces of that signature, juicy fried chicken. Enough for all!
Signature Sides and Sauces
- Coleslaw $8.69
A crisp and tangy cabbage slaw, adding a fresh crunch to your meal.
- Homestyle Mac & Cheese $11.19
Creamy, cheesy macaroni baked to golden perfection. A comforting classic.
- Biscuits $8.69
Freshly baked buttermilk biscuits, flaky on the outside and soft on the inside - a perfect pairing.
- Dipping Sauces $0.59
- Cajun Fries $8.69
Fries seasoned with authentic Cajun spices, delivering a bold and savory kick.
- Red Beans & Rice $8.69
Flavorful red beans served over a bed of seasoned rice. A taste of Louisiana.
- Wing Sauces $0.89
- Mashed Potatoes With Cajun Gravy $8.69
Velvety mashed potatoes smothered in savory Cajun-style gravy. A rich indulgence.
Chicken Sandwiches
- Spicy Chicken Sandwich $6.79
A kicked-up fried chicken sandwich with pickles and spicy mayo on a buttered bun. A fiery fan favorite!
- Classic Chicken Sandwich $6.79
A fried chicken breast filet with pickles and classic mayo on a buttered bun. The original handheld favorite.
- Ghost Pepper Sandwich $6.79
Our buttermilk battered all white meat chicken breast featuring our all-new Ghost Pepper Sauce. Served on a butter toasted brioche bun with barrel cured pickles.
Popeyes Louisiana Kitchen Details
Service options
- Outdoor seating
- No-contact delivery
- Delivery
- Drive-through
- Takeout
- Dine-in
Popular for
- Lunch
- Dinner
- Solo dining
Accessibility
- Wheelchair accessible entrance
- Wheelchair accessible restroom
Offerings
- Comfort food
- Quick bite
- Small plates
Dining options
- Lunch
- Dinner
- Counter service
- Dessert
- Seating
- Table service
Amenities
- Restroom
- Wi-Fi
- Wi-Fi
Atmosphere
- Casual
Crowd
- Family-friendly
- Tourists
Planning
- Accepts reservations
Payments
- Credit cards
- Debit cards
- NFC mobile payments
- Credit cards
Children
- Good for kids
- Kids' menu
Parking
- Free parking lot
- Parking
Popeyes Louisiana Kitchen Photos










Popeyes Louisiana Kitchen Location
Popeyes Louisiana Kitchen
88-08 Northern Blvd, Jackson Heights, NY 11372, USA
Popeyes Louisiana Kitchen Reviews
friesappnapkinsmanagerwingsfamily mealketchupchicken tendersdr. peppercents
★ 5★ 4★ 3★ 2★ 1My name Phonk M, and with my boy Gurt S, and we had a business idea but Gurt Simpson got shot in the Bronx.
September 14 · Mr PlayerPlaysThere was LITERALLY NO ONE inside the store. The two ladies in the front told us to use the kiosk. Told us it was a 15min wait for our order. Someone placed a bag of food on the counter. No one told us it was ours till we got up and asked. Our receipt literally had us as the second customer for the day.
August 03 · V ADI ordered the 14pc spicy tenders family meal. The French fries had a weird after taste and the chicken was not fresh and way too salty. I was very disappointed. We had to trash everything as it was inedible. To add, there was an unusual sensation under the tongue when we chewed the fries.
August 08 · Maria FThe sauce and napkins are complimentary when you order food for pickup. There were no sauce and napkins. When I asked for the sauce, they said extra for the sauce which makes no sense. Please work for customer satisfaction but not work to make your boss happy and add extra charges just for the sauce for customers. This will prevent your customers in the future from ordering the food from your restaurant. Thank you.
April 03 · Kamal GurungAs a business owner the attention and people are so rude. I showed up with my coupon from the app and the guy at the register refused to take my order. After i showed him my coupon he still said no. They are also stating that popeyes has never had honey packs which is a lie. Horrible people wish i could give zero stars
May 18 · Miranda Chassi
More restaurants near me
La Casa del Pollo (Big)3.0 (23 reviews)87-09 Roosevelt Ave, Jackson Heights, NY 11372, USA
Max Bakery & Restaurant4.0 (14 reviews)37-63 90th St, Jackson Heights, NY 11372, USA
Pollos Mario4.0 (4784 reviews)86-13 Roosevelt Ave, Jackson Heights, NY 11372, USA
La Pequena Taste of Italy Pizzeria & Restaurant3.0 (187 reviews)37-72 90th St, Jackson Heights, NY 11372, USA
El Michoacano Bakery0.0 (0 reviews)37-72 90th St, Jackson Heights, NY 11372, USA
El Budare Cafu00e94.0 (1430 reviews)87-21 Roosevelt Ave, Jackson Heights, NY 11372, USA
EL COCINERITO COLOMBIANO4.0 (768 reviews)86-23 Roosevelt Ave, Jackson Heights, NY 11372, USA
Ricos Tamales Mexicanos (Food Cart)4.0 (8 reviews)Triangle 90, 90-02 Roosevelt Ave, Jackson Heights, NY 11372, USA
12 Corazones3.0 (418 reviews)86-22 Roosevelt Ave, Jackson Heights, NY 11372, USA
u00c9l Quetzalito22.0 (38 reviews)86-18 Roosevelt Ave, Jackson Heights, NY 11372, USA
Leou2019s Restaurant & Sports Bar4.0 (692 reviews)84-19 Roosevelt Ave, Jackson Heights, NY 11372, USA
Tia Julia Comida Tipica Mexicana4.0 (119 reviews)40-08 Case St, Elmhurst, NY 11373, USA
Categories
Top Visited Sites
Last Stop Deli3.0 (15 reviews)
Rockaway Plaza Delicatessen4.0 (236 reviews)
Beast & Butterflies4.0 (434 reviews)
The Kati Roll Company4.0 (1411 reviews)
L&B Spumoni Gardens4.0 (297 reviews)
King Wok3.0 (199 reviews)Top restaurants Searches
Trending Dining Insights Posts
How Dessert Shops Are Pioneering New Flavors With Seasonal Ingredients
How Breakfast Restaurants Are Innovating With Healthy Alternatives
Discovering Sushi Restaurants That Source Ingredients Locally and Responsibly
Discovering Bagel Shops That Offer International Flavor Variations
How Middle Eastern Restaurants Are Incorporating Local Ingredients Into Traditional Dishes
Discover the Best American Restaurants That Highlight Regional Specialties
