Dr Smood: Healthy Food & Vegan Options in New York City

Dr Smood Introduce

In the bustling and fashionable neighborhood of SoHo, Dr Smood stands as a beacon for health-conscious New Yorkers. This is more than just a restaurant; it’s a health food store, a cafe, a juice shop, and a tea house all rolled into one. For those seeking a delicious meal that aligns with a healthy lifestyle, Dr Smood offers a welcome refuge from the city's fast-paced dining scene. The focus here is on providing clean, organic, and nutritious food and beverages without compromising on taste. From hearty vegan and vegetarian options to a variety of juices and smoothies, the menu is designed to nourish both the body and the mind.

Dr Smood’s philosophy is built around the idea that food should be both functional and enjoyable. Their menu is a testament to this, featuring organic dishes that are free from artificial additives, refined sugars, and other harmful ingredients. This commitment to quality makes it a popular destination for anyone following a specific diet or simply looking to eat well. Whether you're in the mood for a satisfying breakfast, a light and healthy lunch, or a refreshing drink, Dr Smood has you covered. The welcoming atmosphere, with its casual and comfortable seating, provides the perfect backdrop for a meal that feels good inside and out.

This article will guide you through the key aspects of Dr Smood, providing a comprehensive overview of its location, services, and unique features. We will delve into what makes this spot a worthy choice for a healthy meal in New York City, and why it has garnered a loyal following. The aim is to provide factual and helpful information for anyone in the New York region looking for a place that prioritizes well-being without sacrificing flavor. Dr Smood is a place where you can make smart, delicious choices and feel great about what you're eating.

Dr Smood is located at 470 Broome St, New York, NY 10013, USA, in the heart of SoHo. This prime location is easily accessible for both locals and visitors exploring downtown Manhattan. Situated on the vibrant Broome Street, it is just a short walk from some of the city's most famous boutiques, art galleries, and cultural landmarks. The area is well-served by public transportation, making it convenient to reach from almost any part of the city. The 6, N, Q, R, W, and J lines are all within easy walking distance, ensuring a simple journey for anyone looking to visit.

The surrounding neighborhood of SoHo is known for its energetic atmosphere and historic cast-iron architecture, making the walk to Dr Smood an enjoyable part of the experience. The cafe is also wheelchair-accessible, with a wheelchair-accessible entrance, restroom, and seating, ensuring that it is an inclusive space for all patrons. While parking can be challenging in this part of Manhattan, the excellent public transportation options and the pedestrian-friendly nature of the area make it an ideal choice for a stress-free outing. The location in such a trendy and dynamic area adds to the appeal, making it a perfect spot for a quick break or a leisurely meal.

Dr Smood offers a variety of services to accommodate different dining preferences and lifestyles.

Dine-in Service: Enjoy your meal inside the cafe, which offers a casual and comfortable setting.
Takeout: For those on the go, Dr Smood provides convenient takeout options.
Delivery and No-Contact Delivery: You can have your healthy favorites delivered right to your door with reliable delivery services, including a no-contact option.
Outdoor Seating: The cafe features outdoor seating, perfect for enjoying a meal or a coffee on a nice day while taking in the SoHo streetscape.
Catering: Dr Smood offers catering services, making it a great choice for providing healthy and delicious options for events and gatherings.
Online Ordering: A simple and efficient way to place your order for pickup or delivery.

Dr Smood stands out for its unique features and highlights, which are central to its brand identity.

Organic and Healthy Menu: The entire menu is based on organic, wholesome ingredients. This commitment is evident in all their offerings, from the "Raw Oats W/ Berry Jam" to the "Protein Avocado Toast."
Diverse Offerings: The cafe acts as a multi-faceted health hub, offering coffee, tea, juices, and health food. This wide range of options caters to different cravings and needs throughout the day.
Vegan and Vegetarian Options: A key highlight is the abundance of vegan and vegetarian choices, such as the "Vegan Sandwich" and "Vegetarian options" mentioned in its profile, making it a go-to spot for those on plant-based diets.
Focus on Wellness: The restaurant's name, "Dr Smood," reflects its mission to provide food that is both delicious and beneficial for your health. The "Performance Products" like Smart Snacks are a prime example of this.
Positive Ambiance: The atmosphere is described as being cozy, with features like quiet music and plenty of seating, making it a nice place to relax or get work done. A customer review noted, "We also enjoyed the vibe of the place with quiet music and plenty of seating."
Good for Kids: The cafe is family-friendly, welcoming families with children and making it a great spot for a healthy meal out with the entire family.
Happy Hour: The mention of a "happy hour from 4 to 6 pm" offering a "discount on their healthy drinks" is a great incentive for customers to visit during these hours.

For more information or to place an order, you can contact Dr Smood directly.

Address: 470 Broome St, New York, NY 10013, USA

Phone: (646) 713-1376

Mobile Phone: +1 646-713-1376

Dr Smood is worth choosing because it provides a reliable and high-quality solution for healthy eating in New York City. The city is full of dining options, but finding one that truly prioritizes organic, clean ingredients can be a challenge. Dr Smood makes this easy by having a menu that is entirely dedicated to wellness. This makes it a perfect choice for those who are health-conscious, have dietary restrictions, or are simply looking for a meal that will make them feel good. The variety of menu items, from juices to sandwiches to salads, ensures that there is something for everyone, regardless of their specific cravings.

The value proposition is also a major reason to choose Dr Smood. As one customer noted, the food is "Tasty, healthy, food at a fair price (for New York!)." This combination of quality and reasonable pricing makes it an accessible option for daily meals. The wide range of services, including delivery, takeout, and outdoor seating, adds to its convenience, allowing customers to enjoy their healthy food in a way that best suits their needs. The availability of catering also makes it a practical choice for business lunches or events where you want to offer healthy food.

Ultimately, Dr Smood’s commitment to providing nutritious, flavorful food in a comfortable setting is what makes it a standout choice. It's a place where you can trust the ingredients and enjoy a meal that is both satisfying and beneficial for your health. The cafe's atmosphere, complete with quiet music and a pleasant vibe, enhances the overall experience, making it more than just a place to eat; it's a place to recharge. For New Yorkers seeking a sanctuary of wellness in a busy city, Dr Smood is a clear and compelling choice.

Dr Smood Food & drink

Sides
Rocket Chicken Side $9.95
chicken breast, vegan mayo, dijon mustard, celery, green onions, salt and pepper.
Feta Cheese $3.95
Tortilla Wrap $2.00
Tuna $5.95
Wild pole caught tuna, vegan mayo, dill.
Mustard Lemon Vinaigrette $2.00
Almond Butter Granola $4.00
Cheddar Cheese $2.00
Arugula $2.00
Rainbow Carrots $3.95
Cream Cheese $3.00
Vegan Mayo $2.00
Grape Tomatoes $3.95
Signature Hot Sauce $2.00
Banana $2.00
Red Pesto $3.95
Organic Vanilla Syrup $1.50
Hummus $3.00
Kalamata Olives $4.95
Chicken Breast $8.95
Fresh Jalapeños $2.00
Coconut Yogurt 5oz $4.95
Parmesan Caesar Dressing $2.00
Whole Wheat Sourdough Side (2 Slices) $2.00
Capers $2.00
Romaine Lettuce $2.00
Spinach $2.00
Lemon Wedges (2) $1.00
Avocado $3.95
Red Onions $1.00
Whole Milk 2oz $1.00
Cucumber $2.00
Turkey $6.95
Almond Butter $3.95
Radish $2.00
Bread - Performance $3.95
Chickpeas $2.00
Strawberry $2.95
Salmon (Smoked) $8.95
Roasted Peppers $3.95

Performance Products
Smart Snack Cookie Dough, 12ct $42.00
Smart Meal - Vanilla Cinnamon, 14pack $96.00
Smart Snack Peanut Butter Cup, 1ct $3.50
Drip Coffee (12oz Bag) $21.95
Organic medium roasted coffee beans from Chiapas, Mexico. The beans carry flavor notes of baked apple, chocolate, and almond with a medium body and a delicate acidity level. 12oz.
Smart Snack Lemon Caramel, 12ct $42.00
Smart Snack Peanut Butter Cup, 12ct $42.00
Smart Snack Cinnamon Bun, 1ct $3.50
Espresso Coffee (12oz Bag) $21.95
Organic medium-dark roasted coffee beans from Chiapas, Mexico. The beans carry flavor notes of baked apple, chocolate, and almond with a medium body and a delicate acidity level. 12oz.
Smart Snack Cinnamon Bun, 12ct $42.00
Smart Snack Cookie Dough, 1ct $3.50
Smart Snack Lemon Caramel, 1ct $3.50
Smart Meal - Vanilla Cinnamon Sachet $6.95

Live Smoodys
Cacao Protein $13.95
Almond mylk, banana, cacao protein mix (pea protein, hemp, cacao), almond butter, date paste. 25g of protein.
Strawberry Banana $13.95
Oat mylk, strawberry, banana, coconut probiotic yogurt, date, coconut syrup, topped with goji berries.
Vanilla Cinnamon Banana $15.95
made with Dr Smood Smart Meal, almond mylk, banana.
Green Protein $13.95
Almond mylk, avocado, kale, spinach, banana, moringa, maca, plant protein powder, raw honey, topped with ginger nut crumble. 21g of protein.

Breakfast
Raw Oats W/ Berry Jam $8.95
Almond milk, rolled oats, banana, date, strawberries, blueberries, blackberries, lemon, honey. Non-customizable.
Matcha + Maca Chia Pudding $7.95
Chia seeds, almond mylk, cashew, maca, lucuma, matcha, coconut palm sugar, vanilla, himalayan salt, topping.
Hummus & Bread $13.95
hummus, chickpeas, paprika, extra virgin olive oil w/ wheat sourdough
Smood Yogurt $12.95
coconut yogurt, berry jam, almond butter, gluten-free granola, honey

Promotions
Latte & Pastry Bundle $11.40
Pair one of our artisanal pastries with your favorite latte.
Dr Smood Classic Bundle $16.95
The Avocado Toast Large + Cold Brew Coffee 12oz. No substitutions.

Signature Brews
Lavender Blueberry Latte 16oz $7.50
Blueberry, honey, lemon zest, vanilla extract, & dried lavender. Choice of mylk.
Matcha Tea 16oz $4.50
Dr Smood’s own ceremonial stone ground green tea.
Lavender Blueberry Latte Iced 16oz $7.50
Blueberry, honey, lemon zest, vanilla extract, & dried lavender. Choice of mylk.
Lavender Blueberry Matcha Latte 16oz $8.95
Ceremonial Matcha, Blueberry, honey, lemon zest, vanilla extract, & dried lavender. Choice of mylk, Oat Mylk recommended.
Raw Mocha Iced 16oz $6.95
Espresso, cacao syrup (cacao butter, maple syrup, cacao powder, unrefined coconut crystals, vanilla, Himalayan salt) and your choice of mylk.
Lavender Blueberry Latte 10oz $5.50
Blueberry, honey, lemon zest, vanilla extract, & dried lavender. Choice of mylk.
Hot Cacao 10oz $5.50
Cacao butter, maple syrup, cacao powder, unrefined coconut crystals, vanilla, Himalayan salt.
Hot Cacao 16oz $6.50
Cacao butter, maple syrup, cacao powder, unrefined coconut crystals, vanilla, Himalayan salt.
Matcha Latte 16oz $7.50
Ceremonial stone ground Matcha with your choice of mylk.
Raw Mocha 16oz $6.95
Espresso, cacao syrup (cacao butter, maple syrup, cacao powder, unrefined coconut crystals, vanilla, Himalayan salt) and your choice of mylk.
Matcha Latte Iced 16oz $7.50
Ceremonial stone ground Matcha with your choice of mylk
Raw Mocha 10oz $5.95
Espresso, cacao syrup (cacao butter, maple syrup, cacao powder, unrefined coconut crystals, vanilla, Himalayan salt) and your choice of mylk.
Lavender Blueberry Matcha Latte 10oz $7.50
Ceremonial Matcha, Blueberry, honey, lemon zest, vanilla extract, & dried lavender. Choice of mylk, Oat Mylk recommended.
Matcha Tea Iced 16oz $4.50
Dr Smood’s own ceremonial stone ground green tea.
Matcha Tea 10oz $3.75
Dr Smood’s own ceremonial stone ground green tea
Lavender Blueberry Matcha Latte Iced 16oz $8.95
Ceremonial Matcha, Blueberry, honey, lemon zest, vanilla extract, & dried lavender. Choice of mylk, Oat Mylk recommended.
Matcha Latte 10oz $5.50
Ceremonial stone ground Matcha with your choice of mylk.

Bakery
Cranberry Almond Cookie $6.95
Vegan, gluten free, no refined sugar.
Pumpkin Spice Loaf $6.95
Vegan, gluten free, no refined sugar.
Chocolate Chip Cookie $6.95
Vegan, gluten free, no refined sugar.
Blueberry Almond Loaf $6.95
Vegan, gluten free, no refined sugar.

Teas
White Ginger Tea 16oz $3.75
Fujian white tea, pomegranate, ginger.
Herbal Tea 16oz $3.75
Blackberry, ginger, fennel, cat's claw, honey bush, pai mu tan (caffeine free).
White Ginger Tea Iced 16oz $3.75
Fujian white tea, pomegranate, ginger.
Queen Of Earl Tea 16oz $3.75
Ceylon black tea, italian bergamot, molasses.
Detox Roots Tea Iced 16oz $3.75
Ginger, turmeric, licorice, nutmeg, black pepper and cloves.
Detox Roots Tea 16oz $3.75
Ginger, turmeric, licorice, nutmeg, black pepper and cloves.
Herbal Tea Iced 16oz $3.75
Blackberry, ginger, fennel, cat's claw, honey bush, pai mu tan (caffeine free).
Queen Of Earl Tea Iced 16oz $3.75
Ceylon black tea, italian bergamot, molasses.

Sandwiches & Toasts
Protein Avocado Toast Large $16.95
Avocado, olive oil, hummus, cucumber, chili flakes, Himalayan salt, black pepper.
Wild Salmon Toast $16.95
sourdough, smoked wild salmon, organic cream cheese, cucumber, red onion, capers, herbs (arugula, dill, parsley), lemon
The Avocado Toast Large $14.95
Avocado, olive oil, Himalayan salt, black pepper.
Rocket Chicken Sandwich $16.95
Rocket Chicken mix (chicken breast, vegan mayo, dijon mustard, green onions, celery, Himalayan salt and pepper), arugula on sourdough. Ingredients cannot be removed from mix.
Smood Tuna Melt Sandwich $16.95
sourdough, pole caught tuna, vegan mayo, dill, tomato, cheddar cheese
Vegan Sandwich $15.95
Sourdough, avocado, hummus, spinach, tomato, red pesto, himalayan salt, black pepper.
Oliver's Turkey Sandwich $16.95
sourdough, turkey, avocado, tomato, red pesto

MOSS Beverages
Moss Pomegranate $4.95
Reverse osmosis water, wild sea moss, pomegranate, black currant, hibiscus, tarragon, orange, monk fruit. erythritol (from non-gmo pears and apples).
Moss Pure $4.95
Reverse osmosis water, wild sea moss, lime, monk fruit, erythritol (from non-gmo pears and apples).
Moss Mango $4.95
Reverse osmosis water, wild sea moss, mango, lime, ginger, monk fruit, erythritol (from non-gmo pears and apples).

Wraps
Chicken Vegetable Wrap $16.95
wheat tortilla, chicken breast, avocado, hummus, spinach, red pepper, red onions, vegan mayo. Side salad not included.
Spicy Tuna Wrap $15.95
wheat tortilla, pole caught tuna, dill, vegan mayo, himalayan salt, jalapeños, spinach, radicchio, rainbow carrots, apple. Side salad not included.

Soups
Tomato Soup 8oz $9.95
Tomato, onion, celery, carrot, basil, olive oil, sunflower oil, bay leave, Himalayan salt, with a side of bread.
Butternut Squash Soup 8oz $9.95
Butternut squash, onion, sunflower oil, sweet potato, carrot, tomato, bay leaf, garlic, nutritional yeast, Himalayan salt, with a side of bread.
Butternut Squash Soup 12oz $11.95
Butternut squash, onion, sunflower oil, sweet potato, carrot, tomato, bay leaf, garlic, nutritional yeast, Himalayan salt, with a side of bread.
Gazpacho Soup 8oz $12.95
Tomatoes, red bell pepper, onion, cucumber, sunflower oil, red wine vinegar, Himalayan salt, with a side of croutons.
Gazpacho Soup 12oz $15.95
Tomatoes, red bell pepper, onion, cucumber, sunflower oil, red wine vinegar, Himalayan salt, with a side of croutons.
Tomato Soup 12oz $11.95
Tomato, onion, celery, carrot, basil, olive oil, sunflower oil, bay leave, Himalayan salt, with a side of bread.

Coffee
Cortado $4.25
Espresso, your choice of steamed mylk.
Americano Iced 16oz $5.50
Espresso, iced water.
Cappucino 16oz $6.50
Espresso, your choice of foamed mylk.
Latte Iced 16oz $6.50
Espresso, your choice of iced mylk.
Americano 16oz $5.50
Espresso, hot water.
Americano 10oz $4.50
Espresso, hot water.
Cold Brew Coffee 12oz $4.50
Cold brewed coffee, iced.
Latte 16oz $6.50
Espresso, your choice of steamed mylk.
Espresso $3.00
Double shot espresso.
Cappuccino 10oz $5.50
Espresso, your choice of foamed mylk.
Cold Brew Coffee 16oz $5.50
Cold brewed coffee, iced.
Latte 10oz $5.50
Espresso, your choice of steamed mylk.
Macchiato $3.75
Espresso, your choice of mylk.

Waters & Infusions
Alkaline Water $3.50
Awarded best tasting alkaline water in the world! 16oz.

Bowls & Salads
The Smood Greek Salad $16.95
Arugula, chickpeas, feta, olives, grape tomato, red onion, cucumbers, lemon garlic mustard vinaigrette.
Classic Caesar Salad $14.95
Romaine lettuce, radish, parmesan cheese, herb croutons, caesar dressing (vegan mayo, parmesan cheese, lemon, Himalayan salt, black pepper).

Dr Smood Details

Service options
Outdoor seating
No-contact delivery
Delivery
Takeout
Dine-in

Highlights
Live music

Accessibility
Wheelchair accessible entrance
Wheelchair accessible restroom
Wheelchair accessible seating

Offerings
Coffee
Organic dishes
Vegetarian options

Dining options
Breakfast
Lunch
Catering
Dessert
Seating

Amenities
Gender-neutral restroom
Restroom
Wi-Fi
Wi-Fi

Crowd
Family-friendly

Payments
Debit cards
NFC mobile payments
Credit cards

Children
Good for kids

Dr Smood Photos

Dr Smood Location

Dr Smood

New York New York County New York Broome Street

470 Broome St, New York, NY 10013, USA

Dr Smood Reviews

An average rating of ★3.6 from 278 user reviews.

coffeepricesandwichveganmilkmatchaavocado toastatmospherestaringredients

★ 5★ 4★ 3★ 2★ 1

Not a fan.My kale salad was just a plate of bare kale, with some tomatoes and chicken on top.Nothing special.3/4 available tables were dirty.Ambiance was nice, the floor is really cool!All things considered: Would not recommend.
August 16 · Diederio
Wow! Tasty, healthy, food at a fair price (for New York!). I was full with just the special avocado toast. We also enjoyed the vibe of the place with quiet music and plenty of seating.Tip: happy hour from 4 to 6 pm means a discount on their healthy drinks.
April 12 · Louis Shaffer
A nice place for a seated coffee and breakfast in a serene environment. Or a quick catchup with a friend in Soho - they have lots of space.Extra credit: they make their own plant based milks.However they mixed up my order and I had to have my matcha latte with oat milk instead of coconut. I gave it a shot but I did not like the dates flavor which I guess they add to their oat milk as a sweatener.
November 28 · HANE Xxxx
Omnivore here. Certainly not a vegan. Grabbed a smoody aka refreshing cold summer tasty drink with a friend. Did not know you could combine mango and ginger into a blast of deliciousness. 5/5 will be back for smoodies, friend's avocado salmon dish looked pretty good too. Seating outside looks like good option in summer afternoon.
April 24 · Bo
For the price, you want a consistent product at the VERY least. And beyond that, you want consistent service. They are frequently understaffed and often times the staff are rude! They seem quite bothered to be working there. When the product is as intended it’s great, but that’s about 50% of the time.My first review: (4 stars)This smoothie changed my life. I thought smood was great, delicious, cool space, nice service.
June 02 · Frances